KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1542Help
Entry
Maqu_1542         CDS       T00454                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00061  Fatty acid biosynthesis
maq00780  Biotin metabolism
maq01100  Metabolic pathways
maq01130  Biosynthesis of antibiotics
maq01212  Fatty acid metabolism
Module
maq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Maqu_1542
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Maqu_1542
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Maqu_1542
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maq01004]
    Maqu_1542
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Maqu_1542
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Maqu_1542
Lipid biosynthesis proteins [BR:maq01004]
 Fatty acid synthase
  Component type
   Maqu_1542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABM18626
UniProt: A1U0V7
LinkDB All DBs
Position
1723043..1723828
Genome map
AA seq 261 aa AA seqDB search
MGILSGKKALIVGVASKHSIAYGIAEAFAREGAEMAFTYQNEKLQSRVEKFAEQWGSKLT
FPCDVASDEQIDQVFEQLGKHWDNIDIIIHAVGYAPAHELDGNYVDVTTRDGFRIAHDIS
SYSFVALAKGAREMMHEGSSLLTLSYLGAERVLQNYNVMGLAKASLEANVRYMAASLGKE
GIRVNGISAGPIKTLAASGIKSFRRMLAENAKQAPLRRNVTTEEVGNAAAFMSSDLASGI
TGEILYVDGGFNITGMAEMDA
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctcagtggcaaaaaagcactgattgttggcgtcgccagcaaacattccatt
gcctacggcattgccgaggccttcgctcgtgaaggcgccgaaatggccttcacctatcag
aacgagaaactgcagtcccgcgttgagaagtttgcggaacagtggggcagcaaactgact
ttcccctgtgacgtcgccagcgacgagcagattgaccaggtattcgagcaactgggcaaa
cactgggacaacatcgacatcatcatccatgcggttggttatgcgccggcccatgagctg
gatggaaactacgtggacgtcaccacccgtgacggattccggattgcccacgatatcagc
tcatacagtttcgtggccctcgccaagggcgcgcgcgagatgatgcacgaaggcagcagt
ctgctgaccctgagctacctgggcgccgagcgggtgttgcagaactacaacgtgatggga
ctggcgaaggcatccctggaagccaacgtacgttatatggccgccagcctgggcaaggaa
ggcatccgggtgaacggtatctcagcgggcccgatcaaaactctggccgcttcgggcatc
aagagcttccgccgcatgctggccgagaacgcgaagcaggcccccttgcgtcgtaacgtg
accacagaagaagttggcaacgccgccgccttcatgtcgtccgacctggcatcaggtatc
accggtgaaatcctgtacgtggacggtgggttcaatatcaccggcatggcggagatggac
gcctga

DBGET integrated database retrieval system