KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_1865Help
Entry
Maqu_1865         CDS       T00454                                 

Definition
(GenBank) 3-oxoacyl-[acyl-carrier-protein] synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00061  Fatty acid biosynthesis
maq00780  Biotin metabolism
maq01100  Metabolic pathways
maq01212  Fatty acid metabolism
Module
maq_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Maqu_1865
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Maqu_1865
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maq01004]
    Maqu_1865
Enzymes [BR:maq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     Maqu_1865
Lipid biosynthesis proteins [BR:maq01004]
 Fatty acid synthase
  Component type
   Maqu_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ABM18947
UniProt: A1U1S8
LinkDB All DBs
Position
complement(2081267..2082514)
Genome map
AA seq 415 aa AA seqDB search
MSKRRVVITGMGMLSPVGNDVTSSWEAIRAGRSGIGLIDRFDASEYTTRIGGAVKDLDIE
PWLSSKEARKLDAFIHYGLIAAQQAVDDSGLEQYSKLDKERVGIAIGSGIGGLEYIEKNV
LQMDKAGPRKVSPFFVPASVINMISGNAAIRFGYKGPNIAIVTACTTGTHNIGYAARTIA
YGDADVMLAGGSEMATTRSGVAAFSSARALSTRNDEPEKASRPWDRDRDGFVLSDGAGVV
VLEELEHARARGATIYGEVIGFGMSDDAHHITAPPADGEGAARSMRNAIRDAGISPDLVG
YINAHGTSTQVGDVAEVAAVKSVFGSHAEKLAMSSTKSMTGHLLGAAGAVEAIFSVLAVR
DGVLPPTINLDHPDEGCDLDFVAHKSRDADVKVALSNSFGFGGTNGTLIVSRYEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagcgacgggttgtcatcacgggaatgggtatgctttctccggtggggaatgat
gtgacgtcttcctgggaagccattcgtgccggacgcagtggcatcggactgattgaccgc
tttgacgcgtccgagtacaccactcgcattggcggtgccgtcaaggatcttgatatcgag
ccctggttgtccagcaaggaagcgcgaaagctggatgcctttattcactatggcctgatt
gcagcgcagcaggcggtagatgacagcggccttgagcaatacagcaagctcgacaaggag
cgggtagggattgccataggttcaggtatcggtggcctggaatacatcgaaaagaacgtt
cttcagatggataaggccggcccgcgcaaggtttcgccgttttttgtgccggcatccgtc
atcaatatgatttccggtaatgcggcgatccgtttcggctacaaggggccgaatattgcg
atcgtgaccgcctgtaccactggaacacacaatatcggctatgccgccagaaccatcgcc
tacggcgatgccgatgtcatgctggccggcggctctgaaatggcgaccacacgcagcggc
gtggcggcattttcctccgcccgggccctgtcgacccgcaatgatgagccggaaaaggcc
agtcgcccctgggatcgtgaccgtgacggctttgtactcagtgatggcgccggcgttgtg
gttctggaagagctggaacacgccagggcgcgaggagcaaccatttacggcgaagtcatc
ggctttggtatgagcgatgacgcccatcacatcacggcccccccggccgatggtgagggt
gcggcgcgctccatgcgaaatgccatccgcgatgccggcatcagcccggatctggtcgga
tacatcaatgcccatggaacctccactcaggttggcgatgtggctgaggtggctgcagtc
aaatcggtgtttggcagccatgcggaaaaactggccatgagcagcaccaaatccatgacc
ggacacctgctgggcgccgcgggtgccgttgaggctatattctcggtattggcagtccgg
gacggggtgttgccgcccaccatcaaccttgatcatccggatgaaggttgtgatctggac
tttgtggcgcacaaatccagagatgccgatgtgaaggtcgcgttgtcgaattcgttcggc
tttggcggcaccaacgggaccctgatcgtcagccgctacgagggttga

DBGET integrated database retrieval system