KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2210Help
Entry
Maqu_2210         CDS       T00454                                 

Definition
(GenBank) aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00250  Alanine, aspartate and glutamate metabolism
maq00410  beta-Alanine metabolism
maq00640  Propanoate metabolism
maq00650  Butanoate metabolism
maq01100  Metabolic pathways
maq01120  Microbial metabolism in diverse environments
Module
maq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Maqu_2210
   00650 Butanoate metabolism
    Maqu_2210
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Maqu_2210
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Maqu_2210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:maq01007]
    Maqu_2210
Enzymes [BR:maq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Maqu_2210
Amino acid related enzymes [BR:maq01007]
 Aminotransferase (transaminase)
  Class III
   Maqu_2210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABM19289
UniProt: A1U2S0
LinkDB All DBs
Position
2472483..2473742
Genome map
AA seq 419 aa AA seqDB search
MTDHKGKLSPLLKQATGITAAKGEGAYIIDPEGRRYLDFTSGIGVTSTGHCHPKVVEAAQ
KQVATMIHAQATTVMNPRLPELAEKLGAVTPDPLNAFFFSNAGTEVAEGAIRLVRQATGR
PNVIVFHGGFHGRTMGSLSMTTSSVGLRAGVSPMMGGVVVAPFPHAFHYGWSLDEATDFC
LRELDRIFVTYSAPKETAAMLIEPVQGEGGYVPANARFMQGLRERCDKHGIMLVFDEVQA
GFGRSGKFWAHEHFGVTPDAIMIAKGLASGFPISALAASEETMAKGWPGSQGGTYGGNAV
AAAAAIATIDVIQEEGLVQNADAMGKRLWDNLHSLKKDYPEMADVRGKGLMVGVEMRRGD
CPDGERAGKILKECEKRGLLMLRCGPYQEIVRWLPPLIVNQQQIDEATGIFEEALKATA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccacaaaggcaaactgtcccccctgctcaagcaggctactggcatcaccgct
gccaaaggcgaaggtgcctatatcattgaccctgaaggtcgccgttacctggactttaca
tccggcattggtgtcaccagtaccgggcactgtcacccgaaagtggtggaagccgcccag
aaacaggtagccaccatgatccatgcccaggccaccacagtcatgaacccgagactacct
gaactggcagaaaaactcggcgccgtgacccctgacccgctgaatgccttcttcttttcc
aatgctggcaccgaagttgccgaaggtgccatccgcctggtgcgccaggccaccggccgc
cccaatgtgatcgtattccatggcggctttcatggtcgcaccatgggctcactgtccatg
accacctccagcgtgggcctgcgagccggtgtcagcccgatgatggggggcgtggtcgtc
gcgccattcccccacgccttccattacggctggagcctggatgaggccacggacttctgc
ctgagagagttggatcgcatcttcgtgacctattccgcccccaaggaaaccgcggccatg
ctgattgagccggtccagggcgagggtggctatgtgccggccaacgctcgttttatgcag
gggttgcgggagcgctgcgacaagcacggcatcatgctggtgtttgacgaagtacaggcc
gggttcggccgcagcggcaagttctgggcccacgaacacttcggggtaacacccgacgcc
atcatgatcgccaaaggcctggccagcggcttccccatttctgctctggcggcttcagaa
gaaaccatggccaagggctggccgggttctcagggcggcacctatggcggcaacgctgta
gcggcggctgccgccatagcaaccatcgacgtgattcaggaagagggccttgtgcagaac
gccgatgcgatgggcaaacgcctgtgggacaacctgcacagtttgaaaaaagactacccg
gaaatggcagatgttcggggcaaaggcctgatggttggcgtggagatgcgccgcggagac
tgcccggacggagaacgcgccggcaagatcctgaaagaatgtgaaaagcgggggctgctg
atgctgcggtgtggcccataccaggaaatagtgcgctggctgccgccgctgatcgtcaac
cagcaacagattgacgaagccaccggcatcttcgaagaagcactgaaagccacggcctga

DBGET integrated database retrieval system