KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2234Help
Entry
Maqu_2234         CDS       T00454                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00620  Pyruvate metabolism
maq00680  Methane metabolism
maq01100  Metabolic pathways
maq01120  Microbial metabolism in diverse environments
maq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Maqu_2234
  09102 Energy metabolism
   00680 Methane metabolism
    Maqu_2234
Enzymes [BR:maq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Maqu_2234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ABM19313
UniProt: A1U2U4
LinkDB All DBs
Position
complement(2502157..2504802)
Genome map
AA seq 881 aa AA seqDB search
MTELHPDLRENVRLLGDLLGQSILRFPGQDCYDRIEEIRAAAKADRRQESGSGQRLVKLL
GQLSDDELLPVTRAFNQFLNLANLAEQYHGIRRKQGHPSDLMVESLGEVFDRLKSGGIDP
QELHRKVADLRIEFVLTAHPTEVARRTLILKYDEMSDCLSRLDHDDLMPGEREEIVDRLS
LLIAEAWHTDEIRHERPTAVDEAKWGFAVIENSLWQALPKFLRSLDTSLSEATGQGLPLQ
VSPIRIASWMGGDRDGNPNVTHEVTREVFLLGRWMAADLYLRDIQALRAELSMWQASDEL
RAEVGDSREPYRQVLAQLRERLIKTREWAEASVKGEPADDSGILFENEDLTGPLELCYRS
LMECGLETIANGPLLDTIRRAHTFGLPLIRLDIRQEASRHAEAVAEMVNYLGLGDYLSWS
EQERQAFLVKELKGRRPLVPRNWQPSEPVREVLATCEVVAGQTPEALGSYVISMASKPSD
VLNVILLLREAGMAFPMRVVPLFETLDDLKGAPDSMAALYEVDWYREYCSGRQEVMIGYS
DSSKDAGQLMAAWAQYQAQEKLTEVANRYGVHLTLFHGRGGTVGRGGGPANRAILSQPPG
SVNGSFRITEQGEMIRFKFGLPRLAVQSLTLYTTAVIEATLAPPPVPKDEWREVMDWLTE
RSLRSYREVVRENPDFVPYFRQVTPETALGKLALGSRPARRKATGGVESLRAIPWIFAWT
QMRLMLPSWLGSDVALEQAAQADRLPELREMMQGWPFFRTYVDMLEMVLAKADLRIASYY
EQTLVEDEHLLALGQSLRQRLQGCIERLLELKQQQTLLEQEPVFAHSMKVRNPYTDPLHY
LQAELLRRDRESEGAGKVPELVERALKVTMAGISAGMRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaactgcacccggatcttcgagaaaacgtacgtttgctgggcgatctgcttggc
cagagcatactccgattccccggacaggactgctacgaccgcattgaagaaatccgcgcc
gccgccaaggctgaccggcgccaggaaagcggttccggacaacgcctggtgaagctcctg
ggccagctcagcgatgatgagctgttaccggtgacccgagcctttaaccagtttctcaac
cttgccaacctcgctgagcagtaccacggaattcgtcgcaagcaggggcatccgtcagat
ctgatggtggaatccctgggggaggtgtttgatcggctgaagtccggggggatagacccg
caagagttgcatcggaaggttgcagatttacgcatagagtttgtgctcaccgcgcacccc
accgaagtggcccggcgtacattgatcctcaagtacgatgaaatgtccgattgcctgtcg
aggctggatcatgacgacctgatgcccggtgaacgggaggaaattgttgaccggttgtcg
ctgttgattgccgaggcctggcataccgacgagattcggcatgaaaggccgaccgccgtg
gacgaggccaagtggggcttcgccgttatcgagaacagtctctggcaggcgctgccgaaa
tttctccgtagcctggacacctcgctgtcggaggcgaccggtcaggggcttccgttgcag
gtgtcgccgatccgaattgcctcgtggatggggggagaccgtgatggcaaccccaatgtc
acccacgaagtgacccgggaagtgtttctgcttggtcgctggatggccgcagatctctat
ctgcgcgatatccaggcgctgagagcggagctctccatgtggcaggcaagcgatgaattg
cgggccgaggtgggagattcccgggagccgtatcgccaggtgctggcccagttgagggaa
cgcctgatcaagacccgggaatgggccgaggccagcgtcaagggcgagccggcggacgat
tcgggcattctgtttgagaacgaggatctgaccgggcctttggaattgtgctatcgctcc
ctgatggagtgcgggctggagaccattgccaatggtccgctgctggataccattcgccgg
gctcacaccttcggcctgccactgatccgactggatatccgccaggaggcctcacgccac
gccgaggcggtggcagagatggtgaactacctggggttgggtgactatctgtcctggtcg
gaacaggagcgccaggcgtttctggtcaaggaactgaaagggcggcgccccctggtgccc
cggaattggcaaccctccgagccggtgcgggaggtgctggcaacctgcgaggtggtcgca
ggccagacaccggaagccctgggttcctacgtcatttccatggccagcaagccctcggac
gttttaaacgtgattttgctgctgcgggaagcggggatggctttccctatgcgcgttgtg
ccgctgttcgaaacgttggatgatctcaagggggctcccgacagtatggcggccctgtac
gaggtggactggtatcgggaatactgcagcggacgccaggaagtcatgatcggctattca
gactcctccaaagatgccggccagttgatggcggcctgggcccagtaccaggcccaggag
aagttgaccgaagtggccaatcgatatggagtgcatctgactctgtttcatggtcgcggc
ggcaccgtgggccggggcggtggtccggcgaatcgggcgattctgtcccagccgccgggc
tcggtgaacggcagcttccggattaccgagcagggcgagatgatccgctttaaatttggt
ctgccgaggctggcggtgcagagtctgaccttgtacaccaccgcggtgattgaggcgacc
ctggcgccaccacctgtgccaaaggatgagtggcgcgaggtgatggactggctgaccgag
cgttcgctgcggtcctaccgtgaggtggtccgtgagaatccggattttgtcccttacttc
cgccaggtcacaccggaaacggctctgggtaaacttgcccttggcagccggccggcccgg
cgcaaggccacagggggcgttgaaagcctgagagccattccgtggatttttgcctggacc
cagatgcggttgatgctgccaagctggctgggcagtgatgttgccctcgaacaggcggcc
caggcggaccgcctgcccgaactgcgggagatgatgcagggctggccgttcttccgcacc
tacgtggatatgctggaaatggtcctcgccaaggcagatttgcgtattgccagctattac
gagcagaccctggttgaggacgagcacttgctggcgcttggccagagcctgaggcagcgt
ttgcagggctgcattgagcgtctgctggagcttaaacagcaacagactctgctggagcag
gagccggtgtttgcccattcaatgaaagtccggaacccctacactgatccgctgcactat
ctgcaggcagaattgctcaggcgtgaccgggaaagcgagggggctggaaaggtgccggaa
ttggtcgagagggcgctgaaggtgaccatggccggaatttctgccggtatgcgaaatacc
ggttaa

DBGET integrated database retrieval system