KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_2947Help
Entry
Maqu_2947         CDS       T00454                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Maqu_2947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maq02000]
    Maqu_2947
Enzymes [BR:maq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Maqu_2947
Transporters [BR:maq02000]
 Other Transporters
  Pores ion channels [TC:1]
   Maqu_2947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ABM20021
UniProt: A1U4V2
LinkDB All DBs
Position
3285176..3285844
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSQRILWMLEELGVPYEIQRYERDPETMLAPASLKKVHPLGKSPVITDGD
LVVAESGAIIEYLAHTYGKDTMLPEAGGQQWLDYTYWMHYAEGSLMPPLVMRLVFEKVKT
SPMPFFIKPIAKGISDKTNQIFIGPMIKTHLDFVESQLAKNTWFLGEQLSAADIQMSFPL
EASVARGIVGNDRPNIKAWVARVHARPAYQRALEKGGDYDFA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagttcaccacctcaataattcacgttcacaacgcattctctggatgctggaa
gaactgggcgtgccctacgagatccagcgctatgagcgcgaccctgaaaccatgctggca
ccagccagtctcaagaaggtgcaccccctcggaaagtccccggtcatcaccgacggagat
ctggtggttgccgaatccggtgccatcatcgaatatctggcgcacacctatggtaaagac
accatgctgcccgaagccggaggccagcagtggctggattacacctactggatgcactat
gccgagggctcgctgatgccaccgctggtcatgcgcctggtgtttgaaaaagtgaagacc
agcccaatgccgttctttatcaagccgatcgccaaaggaatttcggacaaaaccaaccag
atttttatcggcccgatgatcaagacccacctggacttcgtggagtcacaactggccaaa
aacacctggtttcttggggaacagctgagtgcggcggatattcagatgagctttcctctg
gaggcatccgtcgcaaggggcatcgttggtaacgacaggccaaacatcaaggcctgggta
gcgcgggtgcatgcgcgccccgcgtaccagagagcactggagaaaggtggagactacgac
ttcgcctga

DBGET integrated database retrieval system