KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3584Help
Entry
Maqu_3584         CDS       T00454                                 

Definition
(GenBank) Pyridoxal-dependent decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq00250  Alanine, aspartate and glutamate metabolism
maq00410  beta-Alanine metabolism
maq00430  Taurine and hypotaurine metabolism
maq00650  Butanoate metabolism
maq01100  Metabolic pathways
maq01110  Biosynthesis of secondary metabolites
maq01120  Microbial metabolism in diverse environments
maq02024  Quorum sensing
Module
maq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:maq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Maqu_3584
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Maqu_3584
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Maqu_3584
   00430 Taurine and hypotaurine metabolism
    Maqu_3584
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Maqu_3584
Enzymes [BR:maq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     Maqu_3584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABM20653
UniProt: A1U6N4
LinkDB All DBs
Position
3960365..3962200
Genome map
AA seq 611 aa AA seqDB search
MASLPDRSYTTQPQGTNAPLGGWQTFFATGPRPAPSDGFPEPTHRIPLNVCGAMTGKKKS
AQASLEAMYRVFTVPEAPESTLSRIDQDISRNLAGFLQEHIVAIERDLSEVEKDFSDYVI
PEKPVFVSEQTQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALNQNLVKTE
TSKAFTPMERQVLGQIHRLVYQEDGSFYRKWMHDPRHALGAMCSGGTVANLTALWVARNR
AFPAEGSFRGLHEEGLFRALKYYGHEGAAIVVSKRGHYSLRKAADVLGLGRDALVPVETD
EFNRIQTDALRDKCLELQKQKIKIMAICGVAGTTETGNVDPLDAMADIAREFGAHFHVDA
AWGGPTLFSRTHRHLLRGIEKADSVTFDAHKQLYVPMGAGLVVFKDPSLASAVEHHAQYI
IRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYEILIDQGIDKAKTFANMIDEQPDF
ELVTRPELNILTYRYCPEDVRQALAMADELQAEKMNTCLNRITKFIQKTQRERGKAFVSR
TRLEPARYYHFPCIVFRVVLANPLTTPDILEDILREQRELSKEDGIADEMAILHQMAAAV
LKQNQKEARQA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcattgcctgacaggtcttatactacgcagcctcagggaaccaatgccccgctt
ggcggctggcagacatttttcgcaaccgggccacgcccggctccatccgacgggtttccg
gaaccaacccatcggataccactgaatgtgtgtggtgctatgaccggaaagaaaaaatcc
gcccaggcctcattagaggcaatgtatcgcgtgttcacggtgcccgaagcgccggagtcg
accctgagccggatcgaccaggacatctcccgtaacctggccggattcctccaggagcac
atcgtcgccatcgaacgggacctgtccgaagtcgagaaagacttctccgactacgtcatc
ccggagaaacctgtttttgtctccgagcagacccagttcctgctcgacaaactggtggcc
aactccgttcataccgcgtcacccgccttcatcggccacatgacctcggcactgccctac
ttcatgctgccgctgtcgaagatcatgatcgccctgaaccagaacctggtgaaaaccgaa
acctccaaagcgttcacgcccatggaacgccaggtactgggccagatacaccggctggtg
taccaggaagacggttctttctatcgtaaatggatgcacgatccccggcacgccctgggc
gccatgtgttccggcgggacggtcgccaacctcaccgccctgtgggtggctcgtaaccgt
gccttccccgctgaaggcagcttccgcggtctgcacgaagaaggcctgttccgcgccctg
aaatactacggccatgaaggcgccgccatcgtcgtgtccaaacgcggccactactccctg
cgcaaagccgccgacgtcctcggtcttggccgggacgccctggtgccagtggaaaccgac
gagttcaaccgcatccagacggacgccctgcgcgacaaatgcctggagctgcagaagcag
aagatcaagatcatggccatctgcggcgtggccggcaccaccgaaaccggcaacgtcgac
ccactggacgccatggccgacatcgcccgggaattcggcgcccatttccacgtcgacgcc
gcctggggcgggccaaccctgttctcccgcacgcaccggcacctgctgcgcggcatcgaa
aaggccgactcggtaaccttcgatgcccacaagcaactgtatgtaccgatgggcgccggc
ctggtggtcttcaaggatcccagtctggccagcgcggtagaacaccacgcccagtacatc
atccggaaaggttcccgggacctcggcagcaccaccctggaaggctcccgcccgggcatg
gccatgctgatccactcaggcctgaaaatcctcgccagagaaggctacgaaattctcatc
gaccagggcatcgacaaagccaaaacctttgccaacatgatcgatgaacaaccggatttc
gaactggtcacccgcccggaactgaacatcctgacctaccgctattgcccggaagatgta
cgccaggcactggccatggccgatgagctgcaggcagaaaagatgaatacctgcctgaac
cgcatcaccaaattcatccagaaaacccaacgggaacgcggcaaagccttcgtctcccga
acccggctggagccagcccgttactatcacttcccgtgcattgtgtttcgggtggttctg
gccaacccgttaacaacgccggatattctggaagatattctcagggagcagagggaactg
tcgaaggaagatgggattgccgatgaaatggccatcctgcaccagatggctgcggcggtt
ttgaagcagaaccagaaagaagcccgacaggcctag

DBGET integrated database retrieval system