KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3695Help
Entry
Maqu_3695         CDS       T00454                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
maq03030  DNA replication
maq03410  Base excision repair
maq03420  Nucleotide excision repair
maq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:maq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Maqu_3695
   03410 Base excision repair
    Maqu_3695
   03420 Nucleotide excision repair
    Maqu_3695
   03430 Mismatch repair
    Maqu_3695
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:maq03032]
    Maqu_3695
   03400 DNA repair and recombination proteins [BR:maq03400]
    Maqu_3695
Enzymes [BR:maq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Maqu_3695
    6.5.1.6  DNA ligase (ATP or NAD+)
     Maqu_3695
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Maqu_3695
DNA replication proteins [BR:maq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Maqu_3695
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Maqu_3695
DNA repair and recombination proteins [BR:maq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Maqu_3695
   NER (nucleotide excision repair)
    Other NER factors
     Maqu_3695
   MMR (mismatch exicision repair)
    Other MMR factors
     Maqu_3695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ABM20764
UniProt: A1U6Z5
LinkDB All DBs
Position
complement(4093100..4093987)
Genome map
AA seq 295 aa AA seqDB search
MPLCNTTRVRAMPLAFSFIVVSIFLSAFGHASGRPPALPLANVYHPGVNLEEYWVSEKLD
GVRAFWDGETLWSRGGYRYSAPAWFTRQFPAQPLDGELWSGRGRFAELSGVVRKVQPVDQ
EWRQVRFYVFDLPEPDRPFEQRYRRLQQLVTAADSRYLVLVEQRVVASHDELMARLEQTV
AAGGEGLMLKRRKSWYQAGRSDDLLKVKKHQDAEATVVAHLPGKGKYEGLLGALEVELES
GRRFRLGTGFTDEERHNPPAIGARVTFRYRGLTATGLPRFASFLRIRNDEPESIE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccactctgcaataccacccgtgtcagggcgatgcctctggcattcagttttattgtt
gtatcaatcttcctttcagcgtttgggcatgccagtggccggccgccggctcttccgctc
gccaatgtctaccatcccggggtcaatctggaagagtactgggtcagtgaaaagctggac
ggtgtccgggcattctgggatggcgagacgctctggtctcggggcgggtacaggtatagc
gcaccggcctggtttacccgtcagtttcccgctcaacccctggatggcgaactctggagc
ggtcgtggccgttttgcggaactatctggcgtagtccgcaaagttcagccagtagaccag
gaatggcgtcaggtgcgcttctacgtatttgatttgcccgagccagatcggccttttgag
caacgctatagacgcttgcaacagctggtgaccgcagcagattcgcgttatctggtactg
gtggaacagcgggtagttgccagccacgatgagctgatggcccggcttgagcaaacggtc
gcggccggtggtgagggactgatgctgaaacgccgcaaaagttggtatcaggcgggccgt
tcagatgacctgctcaaagtgaaaaaacatcaggatgcggaagccacagtggttgctcat
cttcccggcaagggcaagtatgagggattattgggggcactggaggtagagctggaaagt
ggtcgccggttccggcttggcaccgggtttaccgatgaggagcggcacaatccgcctgct
attggcgcccgggttacgttccgctatcgcggcctcacggctacaggcttaccccggttc
gccagctttctaagaattcgtaatgacgaaccggagagtatcgaatag

DBGET integrated database retrieval system