KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_3837Help
Entry
Maqu_3837         CDS       T00454                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Brite
KEGG Orthology (KO) [BR:maq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Maqu_3837
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Maqu_3837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA HI0933_like FAD_oxidored DAO AlaDh_PNT_C K_oxygenase FAD_binding_3 Glutaredoxin NAD_binding_8 FMO-like Thi4
Motif
Other DBs
NCBI-ProteinID: ABM20906
UniProt: A1U7D7
LinkDB All DBs
Position
complement(4256713..4258278)
Genome map
AA seq 521 aa AA seqDB search
MLDANIKGQLKAYMEKLQQPIELVAAYDDSKKSEELKQLLEEIEPMSEKISLRTEESTEV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQEVIQQVQELEGEFE
FETYFSLSCQNCPDVVQALNLMSVLNPNIKHTSIDGALFQDEVEQREVMAVPSVYLNGQP
WGQGRMTLEEIAARLDTNSAEKEARKINQKDAFDVLVIGGGPAGSAAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVNEYEVDIMNMQRAEKLIPAEQTG
GLHEVRLANGGSLKARTLILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGEQMRADEVLQKKLRSLNNVKIITSGQTTEVVGT
DGKVSGLNYTDRTTGESHHVELEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSAE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatatcaaaggacagttgaaggcctatatggaaaagctgcagcagccg
attgagctggtggcagcctatgacgacagcaagaagtccgaggagctcaagcagctgctg
gaagaaatcgagccgatgtccgagaagatcagcctgcggaccgaggaatcgactgaggtg
cgtcgtccgtccttcgccatcaatcgtgtaggcaccgacattggcgttcgctttgccggt
attcccatgggccacgaatttacttcgctggtgctggccctgctgcaggtgggtggccat
ccatccaaggcgtctcaggaagtgatccagcaggttcaggagctggaaggtgagttcgag
tttgaaacctacttctcgctgtcctgccagaactgcccggacgtggttcaggcgctgaac
ctgatgagcgtgctgaacccgaacatcaagcacacctccattgacggtgccctgttccaa
gacgaagttgagcagcgtgaagtgatggcggtacccagtgtttacctgaatggccagccc
tggggccagggccggatgacgctggaagagattgcggccaggctggacaccaactcggct
gaaaaagaagctcgtaagatcaaccagaaagatgcgtttgacgttctggtgatcggtggc
ggcccggcaggttctgctgctgctatctatgccgcacgaaagggcatttcgaccggtatc
gcggctgagcgttttggtggccaggtggccgacaccatgggcatcgaaaacctgatttcc
gtgccttataccgaaggcccgaaactggtggcggccatggagcagcacgtcaacgaatac
gaagtcgacatcatgaacatgcagcgtgccgagaagctgattccggccgagcagaccgga
ggcctgcacgaggtacgcctggccaacggcggctctctgaaagctcgcacgctgattctg
tccaccggtgcccgctggcgccagatgggtgtgccgggtgaggaagagtaccgcaacaag
ggcgtggcctactgcccgcattgcgacggcccgctgttcaaaggcaagcgcgtagcggtg
attggcggtggtaactccggcgtggaagcggccatcgacctggcaggtattgtcggccac
gtgacgctgatcgagtttggcgagcagatgcgtgccgatgaagtgctgcagaagaaactt
cgcagtctgaacaacgtgaagatcattacgtctggccagaccacggaagtggtgggtacc
gatggtaaggtcagcggcctgaactacaccgaccgtaccaccggtgagtcgcatcacgtt
gagctggaaggcgtgtttgttcagatcggcctggtgccgaacaccgagtggctgaaaggc
gacatcgaactgagccagcacggcgagatcatcgtaaatgaccgtaacgagacttcgatc
ccgggtgtgttcgcggcaggcgatgccaccaccgtgccctacaagcagatcgtgatctct
atgggtgaaggttccaaggctgccctgagcgccttcgacttcctgatccgtaactctgct
gagtaa

DBGET integrated database retrieval system