KEGG   Methylobacterium aquaticum: Maq22A_1p32490Help
Entry
Maq22A_1p32490    CDS       T04311                                 

Definition
(GenBank) collagen triple helix repeat
Organism
maqu  Methylobacterium aquaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Hint_2
Motif
Other DBs
NCBI-ProteinID: BAQ48808
UniProt: A0A0C6FK35
LinkDB All DBs
Position
pMaq22A_1p:513724..516141
Genome map
AA seq 805 aa AA seqDB search
MTGAQGTTGAQGATGAQGSTGAQGTTGAQGTTGAQGATGVQGTTGAQGSTGAQGTMGAQG
ATGAQGATGAQGTTGAQGTTGAQGTTGAQGATGTQGTTGAQGATGAQGTTGAQGTTGAQG
ATGVEGATGAQGTTGAQGTTGAQGTTGAQGATGVQGATGSQGAIGTQGVTGAQGATGDQG
VQGVTGSQGATGAQGVAGAQGATGVQGATGAQGATGAQGTTGAQGTTGAQGTTGAQGATG
VQGATGSQGATGAQGVTGSQGATGVQGATGSQGVTGSQGATGAQGVTGSQGATGAQGATG
SQGVTGSQGATGVQGATGSQGVTGSQGATGAQGVTGSQGATGAQGATGSQGVTGSQGATG
AQGATGSQGATGSQGATGAQGVTGSQGATGVQGATGAQGVTGSQGATGAQGVTGSQGATG
VQGATGAQGVTGSQGATGAQGVTGSQGATGVQGATGAQGVTGSQGATGAQGVTGSQGATG
VQGATGAQGVTGSQGATGAQGVTGSQGATGVQGATGAQGVTGSQGATGAQGVTGSQGATG
AQGATGAQGVTGATGPTGSAGTTGATGPTGAGGATGATGPTGATGPEGATGATGPVICFA
RGTMILTPEGERPVESLRPGDVVVTAAGETVPVAWVGHRHLDLTRHPRPERARPVRIAAH
AFGPGLPQRDLVVSPGHALFVDDVLIPAGSLVNGTSVAQLDRAEVIYHHVELPVHDVLVA
DGMPAESYLDCGNRGTFENHDGPVALHPDLVASALNLELACAPVVLHGPIVDRVRARLAA
QDARSGTERTADAGPSFLARLLRRA
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtgcgcagggtacaacgggtgcgcagggcgcgacgggcgcgcagggtagcacc
ggcgcgcagggcacgacgggcgcacagggcaccaccggcgcgcagggcgccacgggggtc
cagggcacgacgggtgcgcagggtagcaccggcgcccagggtacgatgggtgcgcagggc
gccaccggcgcacagggcgcaacgggcgcgcagggcaccactggtgcccagggcacgacg
ggcgcacagggcaccaccggcgcgcagggtgccacgggtacccagggtaccaccggtgcc
cagggtgcgacgggcgcgcagggtaccaccggtgcccagggcacgacgggtgcgcagggc
gcgacaggcgtcgagggcgcaacgggtgcgcagggtacaactggagcccaggggacgacc
ggtgcgcagggcaccaccggcgcccaaggcgcgaccggcgtgcagggtgcgaccggctct
cagggcgcgatcggaacgcaaggcgtgacgggggcccagggtgcgaccggcgaccagggc
gtacagggtgtgaccggctcgcaaggtgccaccggcgctcagggcgtcgccggtgcgcag
ggcgcgaccggcgtccagggtgccacgggtgctcagggtgcaacgggtgcgcagggtacc
accggtgcccaggggacgaccggtgcgcagggcaccaccggcgcccaaggcgcgacggga
gtgcagggcgcgaccggctcgcaaggtgccaccggtgcccagggcgtcaccggttcgcag
ggcgcgaccggcgtccagggtgccaccggctcccagggcgtgaccggctcgcaaggcgcg
acgggagcccagggtgtcaccggttcgcagggcgcgaccggtgcccagggtgctaccggc
tcccagggcgtcaccggttcgcagggcgcgaccggcgtccagggtgccaccggctcccag
ggcgtgaccggctcgcaaggcgcgacgggagcccagggtgtcaccggttcgcagggcgcg
accggtgcccagggtgctaccggctcccagggcgtcaccggttcgcagggcgcgaccggt
gcccagggtgccaccggctcccagggcgcaaccggctcgcaaggtgcaacgggggcccag
ggcgtcaccggttcgcagggcgcgaccggcgtccagggtgccaccggtgcccagggcgtg
accggctcgcaaggcgcaacgggggcccagggcgtcaccggttcgcagggcgcgaccggc
gtccagggtgccaccggtgcccagggcgtgaccggctcgcaaggcgcgacgggagcccag
ggcgtcaccggttcgcagggcgcgaccggcgtccagggtgccaccggtgcccagggcgtg
accggctcgcaaggcgcgacgggagcccagggcgtcaccggttcgcagggcgcgaccggt
gtccagggtgccaccggtgcccagggcgtcacgggctcgcaaggcgcgacgggagcccag
ggcgtcaccggttcgcagggcgcgaccggtgtccagggtgccaccggtgcccagggcgtc
acgggctcgcaaggcgcgacgggagcccagggcgtcaccggttcgcagggcgcgaccggc
gctcagggtgccaccggcgcccagggcgtcacgggggccaccggtccgaccggatccgcg
ggtaccacgggcgcgaccggtccgacgggtgccggcggcgcgacgggggccaccggtccg
acgggcgcgaccggtccggagggagccaccggtgcgaccggcccggtcatctgcttcgca
cgcggcacgatgatcctgacgcctgagggcgagcgcccggtcgagtccctgcggcccggc
gacgtcgtcgtcaccgccgccggggagacggtcccggtcgcttgggtcggtcaccgtcac
ctcgacctcacccgtcacccgcggcccgagcgggcccggccggtgcggatcgcggcgcac
gccttcgggcccggcctgccgcaacgcgacctcgtcgtctcgcccggccacgcgctcttc
gtcgacgacgtgctgatcccggccggcagcctggtcaacggcacctcggtggcgcagctc
gaccgggcggaggtgatctaccaccacgtcgagctgccggtgcacgacgtgctggtcgcc
gacgggatgcccgccgagagctacctcgattgcggcaaccgcggcaccttcgagaaccac
gacggcccggtcgccctgcatccggacctcgtcgcttcggcgctgaacctggagctggcc
tgcgcgccggtcgtcctccacggcccgatcgtcgaccgggtccgggcgcggctcgccgcg
caggacgcccggtccggcaccgagcgcacggccgacgccgggccctcgttcctcgcgcgc
ctcctgcggcgggcgtga

DBGET integrated database retrieval system