KEGG   Methylobacterium aquaticum: Maq22A_1p32995Help
Entry
Maq22A_1p32995    CDS       T04311                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00040  Pentose and glucuronate interconversions
maqu00051  Fructose and mannose metabolism
maqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Maq22A_1p32995
   00051 Fructose and mannose metabolism
    Maq22A_1p32995
Enzymes [BR:maqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Maq22A_1p32995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: BAQ48898
UniProt: A0A0C6FKA9
LinkDB All DBs
Position
pMaq22A_1p:614145..615134
Genome map
AA seq 329 aa AA seqDB search
MTSAPVRFATRLNSFASQPDAFWPKGHGKPSPLEMAARAATARGLTDVDLNFPDHLGPDP
RATGNAIRDLGLTVNGLAMRYYSNPAFKIGAFTNPDPAVRREAIDLTKRGIDAGREAGCN
LMTLWLGQDGFDYAFQADYPKLWADEIDGIREVALHDPECLISIEYKPNEPRSYSLLPDC
ATTLLALKEIDLPNLGVTLDFAHVLYADEQPAFVAALIGRHSRILGLHLNDGYAKRDDGL
MVGAVHPVQTIELLRQVRKDGFHGPIYFDTFPDLTGLDPVAECEANIATVTAMLGVVDKL
EGDNELSAAIARQDAVASQNLVRRAMLGR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
gtgacatccgcccccgtgcgcttcgcgacgcgcctgaactcgttcgcctcgcagcccgac
gccttctggcccaagggccacggcaagccgagcccgctggagatggcggcccgcgccgcg
acggcgcgcggcctgaccgacgtcgacctgaactttcccgatcacctggggcccgatccg
cgggcgaccggcaacgcgatccgcgacctcggcctgaccgtgaacggcctggcgatgcgc
tactactccaacccggccttcaagatcggcgccttcaccaaccccgacccggcggtgcgg
cgcgaggccatcgacctgacgaagcgcggcatcgacgcgggccgcgaggccggctgcaac
ctgatgaccctgtggctcggccaggacggcttcgactacgccttccaggccgactacccc
aagctctgggccgacgagatcgacggcatccgcgaggtcgcgctgcacgatcccgagtgc
ctgatcagcatcgagtacaagccgaacgagccgcgctcctacagcctgctgcccgactgc
gcgacgaccctgctggcgctgaaggagatcgacctgccgaatctcggcgtcacgctcgac
ttcgcgcacgtcctctacgccgacgagcagccggccttcgtggcggcgctgatcggccgg
cacagccgcatcctcggcctgcacctcaacgacggctacgccaagcgcgacgatgggctg
atggtcggtgcggtccacccggtccagacgatcgagctcctgcggcaggtccgcaaggac
ggcttccacgggccgatctacttcgacaccttcccggatctgaccggcctcgacccggtg
gccgagtgcgaggccaacatcgccaccgtgacggcgatgctcggcgtcgtcgacaagctc
gagggcgacaacgagctgagcgcggcgatcgcccgccaggacgcggtcgcgagccagaac
ctcgtccgcagggcgatgctcggccgctga

DBGET integrated database retrieval system