KEGG   Methylobacterium aquaticum: Maq22A_2p41230Help
Entry
Maq22A_2p41230    CDS       T04311                                 

Gene name
araC
Definition
(GenBank) AraC family transcriptional regulator
Organism
maqu  Methylobacterium aquaticum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC DUF977
Motif
Other DBs
NCBI-ProteinID: BAQ50023
UniProt: A0A0C6FNT8
LinkDB All DBs
Position
pMaq22A_2p:213952..214902
Genome map
AA seq 316 aa AA seqDB search
MRTAFSTAHAEPAERKSAWSEAVSRTYFPLELGFRPGPAFSGALEVWNLGDLAISRNVSD
GLVYRRHTHHLLHAHYESFLITVPERAEVSFRQDGKDVRCRPGAFLIERSHLPYEFAYTE
PNALWVLKVPSPVLRARIGAPERLATLSFDATQGVGALFVDMLRLTAPRVQELDEAGRAM
AGRHLVDLLALAVEADPRTLGSQASSVQGAHLHRVERYIRANLARADLGPQGIAEACGLS
VRYLHQLFETQGTSVCGFVRRQRLAMCDEALRDPACRRSLSEIAYRWGFGDQAQFSRQYR
AEFGCTPREARAAARG
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgcgttctcgaccgcgcacgccgagccggcggagcgcaagtccgcctggagc
gaggcggtgagccggacctacttcccgctcgagctggggtttcgacccggcccggccttc
tccggcgccctcgaggtctggaacctcggcgatctcgcgatctcgcgtaacgtttcggac
ggccttgtctaccgccgccacacccaccacctgctccacgcccactacgagagcttcctg
atcaccgtcccggagcgggcggaggtgagctttcgccaggacggcaaggacgtgcgctgc
cggcccggcgccttcctgatcgagcgcagccacctgccctacgagttcgcctacacggag
ccgaacgccctctgggtgctcaaggtgccgagcccggtgctgcgcgcccggatcggagcg
cccgagcgcctcgccaccctgagcttcgacgcgacgcagggcgtcggcgccctcttcgtc
gacatgctgcggctgaccgcaccgcgggtccaggagctagacgaggcgggccgggcgatg
gccgggcgccacctcgtcgatctcctggctctcgcggtcgaggccgacccgcggacgctg
ggcagccaggcgtcctcggtccagggcgcgcacctgcaccgggtcgagcgctacatccgc
gccaacctcgcccgcgccgatctcgggccgcaggggatcgccgaggcctgcggcctctcg
gtgcgctacctgcaccagctgttcgagacgcaggggaccagcgtctgcggcttcgtccgc
cgccagcggctggcaatgtgcgacgaggccctgcgcgaccccgcctgccgccgctcgctc
tccgagatcgcctatcgctggggcttcggcgaccaggcccagttcagccgacagtaccgg
gccgagttcggctgcactccgcgggaggcgcgggcggcggcgagggggtga

DBGET integrated database retrieval system