KEGG   Methylobacterium aquaticum: Maq22A_c03250Help
Entry
Maq22A_c03250     CDS       T04311                                 

Gene name
tauC
Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00910  Nitrogen metabolism
maqu02010  ABC transporters
Module
maqu_M00438  Nitrate/nitrite transport system
maqu_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Maq22A_c03250 (tauC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Maq22A_c03250 (tauC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:maqu02000]
    Maq22A_c03250 (tauC)
Transporters [BR:maqu02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    Maq22A_c03250 (tauC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: BAQ44096
UniProt: A0A0C6EVN1
LinkDB All DBs
Position
629477..630337
Genome map
AA seq 286 aa AA seqDB search
MALGTTLGRVAAVKPEGARRPLVTRAALKGLALRIVPPLVVLAVFLLLWEVLCQRPGAGL
PPPSRVVTEAWDIIAHPFYDNGGTDKGLFWHISASLQRVALGFTLAVIAGVMLGTLVGQS
EWAMRGLDPIFQVLRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIRNI
PQDYRNVAAVLRLNAFEFFAKVMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGF
FIWDAWNSSHISEIIVALVYVGVIGFVLDRLVAGLGHLVTRGTATA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggctctcggaaccaccctcgggcgcgtcgccgccgtcaaaccggagggggcccgccgc
cccctcgtcacccgcgccgccctcaagggcctggcgctgcggatcgtcccgccgctcgtc
gtgctggcggtcttcctgctgctctgggaagtgctgtgccagcgccccggcgccggcctg
ccgccgccctcgcgcgtcgtcacggaggcctgggacatcatcgcccacccgttctacgac
aacggcggcaccgacaaggggctcttctggcacatcagcgccagcctccagcgggtggcg
ctcggcttcaccctggcggtgatcgccggcgtgatgctgggcaccctcgtcggccagtcg
gaatgggcgatgcgcgggctcgacccgatcttccaggtcctgcgcaccatcccgccgctc
gcctggctgcccttgtcgctcgccgccttccgggacggccagccctcggcgatcttcgtg
atcttcatcacctcgatctggccgatcatcatcaacaccgcggtcggcatccgcaacatc
ccgcaggactatcgcaacgtcgcggcggtcctgcgcctcaacgccttcgagttcttcgcc
aaggtgatgctgccctcggccgcaccctacatcttcaccggtcttcgcatcggcgtcggc
ctgtcctggctcgccatcgtggcggccgagatgctgatcggcggcgtcggcatcggcttc
ttcatctgggatgcctggaactcctcgcacatcagcgagatcatcgtggccctggtctat
gtcggggtgatcggcttcgtgctcgaccgcctcgtcgccggcctcggccacctcgtcacc
cgcggcaccgccacggcctga

DBGET integrated database retrieval system