KEGG   Methylobacterium aquaticum: Maq22A_c04315Help
Entry
Maq22A_c04315     CDS       T04311                                 

Gene name
fabI
Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00061  Fatty acid biosynthesis
maqu00780  Biotin metabolism
maqu01100  Metabolic pathways
maqu01130  Biosynthesis of antibiotics
maqu01212  Fatty acid metabolism
Module
maqu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Maq22A_c04315 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Maq22A_c04315 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Maq22A_c04315 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maqu01004]
    Maq22A_c04315 (fabI)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Maq22A_c04315 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Maq22A_c04315 (fabI)
Lipid biosynthesis proteins [BR:maqu01004]
 Fatty acid synthase
  Component type
   Maq22A_c04315 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: BAQ44286
UniProt: A0A0C6EWB6
LinkDB All DBs
Position
836909..837751
Genome map
AA seq 280 aa AA seqDB search
MQDDGQAASLKTGLLAGKRGLVLGVANNRSIAWGIAKSAHQHGAQLAFTYQGEALKKRVE
PLARELDAAVVGHCDVTDPASIDAAFEATGRHFPEGIDFVIHCIAFSDKDELTGRYIETS
EANFSKSLLISCYSFTAVAQRAEKLMRNGGSLLTLTYYGAEKWMPHYNVMGVAKAALEAS
VRYLAADLGPQKIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIDEVGETA
AYLISDMSRGMTGEILHVDAGYHVVGMKNPEAPDLSLDKD
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggatgacgggcaggccgcatccctgaagaccgggctcctcgccggcaagcgcggc
ctcgtgctcggcgtcgccaacaaccgctcgatcgcctggggcatcgccaagagcgcccac
cagcacggcgcgcagctggccttcacctaccagggcgaggcgctgaagaagcgcgtcgaa
ccgctcgcgcgcgagctcgacgcggcggtcgtcggccactgcgacgtcaccgacccggcc
tcgatcgacgcggccttcgaggccaccggccggcacttccccgaggggatcgacttcgtc
atccactgcatcgccttctcggacaaggacgagctgaccggccgctacatcgagaccagc
gaggcgaacttctcgaagtcgctgctgatctcctgctactcgttcacggccgtggcccag
cgggccgagaagctgatgcgcaacggcggctcgctcctcacgctgacctattacggcgcc
gagaagtggatgccgcactacaacgtgatgggcgtcgccaaggccgcgctcgaggcctcg
gtgcgctaccttgcggccgatctcggcccccagaagatccgcgtcaacgcgatctcggcc
ggcccgatcaagacgcttgccgcctccggcatcggcgacttccgctacatcctgaagtgg
aacgagtacaacgcccccttgcgccgcaccgtgacgatcgacgaggtcggcgagaccgcc
gcctacctgatctccgacatgtcgcgcggcatgaccggcgagatcctgcacgtcgatgcc
ggctaccacgtcgtgggcatgaagaatcccgaggcgccggacctcagcctcgacaaggac
tga

DBGET integrated database retrieval system