KEGG   Methylobacterium aquaticum: Maq22A_c05795Help
Entry
Maq22A_c05795     CDS       T04311                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
maqu01100  Metabolic pathways
maqu01110  Biosynthesis of secondary metabolites
maqu01130  Biosynthesis of antibiotics
maqu01230  Biosynthesis of amino acids
Module
maqu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maq22A_c05795 (aroK)
Enzymes [BR:maqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     Maq22A_c05795 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 dNK AAA_22 Cytidylate_kin MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: BAQ44528
UniProt: A0A0C6F849
LinkDB All DBs
Position
1054311..1054991
Genome map
AA seq 226 aa AA seqDB search
MSQRPPHEPSIESRVRRGLGLRSIVLVGLMGAGKSTVGKRLAGRLGLIFKDADHEIEAAA
GLTIPDIFAIYGEPSFRDGEERVIARLLREGPMVLATGGGAFMRPETRQRIGEAGVSVWL
KADLDVLMRRVRKRPGRPLLQNEDPEGTMRRLMDLRHPVYGGADVMVVSREVSHDRVVQD
VLEALDAHMLGDPADGYAGGAAGDPTGSPPETGGEPETAGHSFAAH
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcgcccccctcatgagccatcgatcgagtcgcgcgtgcgccgaggcctcggc
ctgcgctcgatcgtgctggtcggcctcatgggcgcgggcaagagcaccgtcggcaagcgc
ttggcgggccgcctcggcctgatcttcaaggacgccgaccacgagatcgaggccgcggcc
ggcctgaccatcccggacatcttcgccatctacggcgagccgagcttccgcgacggcgag
gagcgggtgatcgcccgcctgctgcgcgaggggccgatggtgctcgccaccggcggcggc
gccttcatgcggcccgaaacccgccagcgcatcggcgaggccggggtctcggtctggctc
aaggccgatctcgacgtgctgatgcgccgggtgcgcaagcggccgggccggccgctgctc
cagaacgaggatcccgagggcacgatgcggcggctgatggacctgcgccatcccgtctat
ggcggggccgacgtgatggtggtctcccgcgaggtctcgcacgaccgggtggtgcaggac
gtgctggaagccctcgacgcccacatgctgggcgacccggcggacggctatgccggcggc
gcggcgggcgatcccacgggctcgccgcccgagaccggcggggagcccgagaccgccggg
cacagcttcgccgcccattga

DBGET integrated database retrieval system