KEGG   Methylobacterium aquaticum: Maq22A_c11120Help
Entry
Maq22A_c11120     CDS       T04311                                 

Gene name
amyA
Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00500  Starch and sucrose metabolism
maqu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Maq22A_c11120 (amyA)
Enzymes [BR:maqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Maq22A_c11120 (amyA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Maq22A_c11120 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: BAQ45489
UniProt: A0A0C6FK33
LinkDB All DBs
Position
2116803..2118467
Genome map
AA seq 554 aa AA seqDB search
MIEDLWYKNAVIYCLSVGSFMDANGDGIGDFEGLERRLDYLLGLGVTAIWLHPFQPSPGR
DHGYDVADYYGVDPRYGTLGDFVAFTHAAKQRGMRVLIDLVVNHTSDQHPWFKAARSDPN
ARTRDWYVWSKTKPANAHEGVVFPGVQKSTWTYDKEAKAWYFHRFYDFQPDLNTANPHVQ
AEILKIMGFWIQLGVSGFRMDAVPFVIAEKGPEVSGEPREQFELLRLFREFLQWRQGDAI
ILAEANILPRQDLDYFGEDADRMHMMFNFQVNQALFYALASADARPLVKALQKTWNRPPS
AQWAIFLRNHDELDLGRLTEKQRQTVFQAFGPDPDMQLYDRGIRRRLAPMLGGDRRRIEL
AYSLMFTLPGTPVLRYGDEIGMGDDLSLPERDCARTPMQWSHEPQGGFTLSDHPESPPIH
EGPYAYSHVNAAAQRCAPESLLNWMERIIRMRKEVPEIGWGDFTALETGDPGILALRYDW
RNTAVLCLHNLAGEPKEITFATGLDGDGRNLIDLLTGQRSLANDDGCHCVLLEGYGYRWY
RVGGLDYLLRRSEI
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaggacctctggtacaagaacgcggtgatctactgcctctcggtcggctcgttc
atggatgccaacggcgacggcatcggcgatttcgagggactggagcggcgcctcgattat
ctgctcgggctcggcgtgacggcgatctggctgcacccgttccagccctcgccgggccgc
gaccacggctacgacgtggccgactattacggcgtcgacccgcgctacggcaccctcggc
gacttcgtcgccttcacccacgccgccaagcagcgcgggatgcgggtgctgatcgacctc
gtggtcaaccacacctccgaccagcatccgtggttcaaggccgcccgctccgaccccaac
gcccgcacccgcgactggtacgtctggtcgaagacgaaaccggccaacgcccacgagggc
gtggtcttcccgggcgtgcagaagagcacctggacctacgacaaggaagccaaggcctgg
tacttccaccggttctacgacttccagcccgacctcaacaccgccaacccccacgtccag
gccgagatcctcaagatcatggggttctggatccagctcggcgtctcgggcttccggatg
gacgcggtgccgttcgtcatcgccgagaaggggccggaggtttcgggcgagccgcgtgag
cagttcgagctcctgcgcctcttccgcgagttcctgcaatggcgccagggcgacgcgatc
atcctggcggaggccaacatcctgccgcgccaggacctcgactatttcggcgaagacgcc
gaccgcatgcacatgatgttcaacttccaggtcaaccaggcgctgttctacgcgctcgcc
tcggccgatgcgcgcccgctggtgaaggcgctgcagaagacctggaaccgcccgccctcc
gcccagtgggcgattttcttgcgcaaccacgacgagctcgacctcgggcggctcaccgag
aagcagcgccagaccgtctttcaggccttcggccccgacccggacatgcagctctacgac
cgcggcatccgccggcggctggcgccgatgctcggcggcgaccggcgccggatcgagctc
gcctacagcctgatgttcaccctgccggggacgccggtcctgcgctacggcgacgagatc
ggcatgggcgacgacctctcgctgcccgagcgcgactgcgcccgcacgccgatgcagtgg
tcgcacgagccccagggcggcttcacgttgagcgaccacccggaatcgccgccgatccac
gaggggccctacgcctattcccacgtcaacgcggcggcgcagcgctgcgcgccggaatcg
ctcctcaactggatggagcgcatcatccgcatgcgcaaggaggtgccggagatcggctgg
ggcgacttcaccgcgctcgagaccggcgatcccggcatcctcgccctgcgctacgactgg
cgcaacaccgcggtgctgtgcctgcacaacctcgcgggcgagccgaaggagatcaccttc
gccaccggcctcgacggcgacggccgcaacctgatcgacctgctgaccggccagcgcagc
ctcgccaacgacgacggctgccactgcgtgctcctggagggctacggctaccgctggtac
cgggtggggggcctggactacctgctgcggcgcagcgagatctga

DBGET integrated database retrieval system