KEGG   Methylobacterium aquaticum: Maq22A_c11955Help
Entry
Maq22A_c11955     CDS       T04311                                 

Gene name
glpA
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00564  Glycerophospholipid metabolism
maqu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Maq22A_c11955 (glpA)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Maq22A_c11955 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C NAD_binding_8 FAD_oxidored Pyr_redox_2 FAD_binding_3 FAD_binding_2 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: BAQ45640
UniProt: A0A0C6FS47
LinkDB All DBs
Position
2291039..2292547
Genome map
AA seq 502 aa AA seqDB search
MFDLAVIGGGINGCGIARDAVGRGASVVLFEQNDLASGTSSTSTKLIHGGLRYLEHYEFR
LVREALMEREVLWGMAPHIVWPLRFVLPHHSGLRPGWLLRLGLLLYDNLGGRKRLPGTRT
LDLTRDPAGEPLKAGFRRAFEYSDCWVEDSRLVVLNARDAAERGAVIRPRTRVVTAARSG
GLWELTVEDRETGARDTVRARTLVNAAGPWVADVLTGVARANSSEGVRLVQGSHIVVRRL
FRHDRAYIFQNADQRIIFAIPYERDFTLIGTTDRDYTGDPADVKASEEEIAYLCAAASEY
FRDPVTRDEVVWTYSGVRPLYDDGASKAQEATRDYVLTLDAPQGQPAMLSVFGGKITTYR
RLAESALDRLKDHLPAARKEPWTSGAVLPGGNFPKESYDDIVAGLARQHPGVPEALVARL
VRAYGTDAREILSGARSMADLGRLFGADLTEREVRHLMRREWASRAEDVLWRRSKLGLRV
TPAEAEALDEFMRRAAAAPNAA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacctcgcggtgatcggtggcggcatcaacggctgcggcatcgcccgcgacgcg
gtgggccgcggcgcctcggtggtgctgttcgagcagaacgacctcgccagcggcacctcc
tcgacctcgaccaagctgatccacggcggcctgcgctacctggagcattacgagttccgc
ctggtccgcgaggccctgatggagcgcgaggtcctgtggggcatggcgccccacatcgtc
tggccgctgcgcttcgtgctgccgcaccattccggcctgcgccccggctggctcctgcgc
ctcgggctcctgctctacgacaacctcggcggccgcaagcgcctgcccggcacccgcacc
ctcgacctcacccgcgatccggccggcgaaccgctcaaggccggctttcgccgcgctttc
gaatattcggattgctgggtcgaggattcgcggctcgtggtgctgaacgcccgcgacgcc
gccgagcgcggcgcagtgatccgcccacgcacccgggtcgtcaccgccgcgcgcagcggc
ggcctgtgggagctgacggtcgaggaccgggagaccggcgcccgcgacacggtgcgggcg
cgcaccctcgtcaacgccgccggcccctgggtcgccgacgtgctcaccggcgtggcgcgg
gccaattcctcggagggcgtgcgcctcgtccagggcagccacatcgtggtgcggcgcctg
ttccggcacgaccgggcctacatcttccagaacgccgaccagcgcatcatcttcgcgatc
ccctacgagcgcgacttcacgctgatcggtaccaccgaccgcgactacacgggcgacccc
gccgacgtgaaggcgagcgaggaggagatcgcctatctctgcgccgccgccagcgagtac
tttcgcgatccggtcacccgcgacgaggtggtgtggacctattcgggcgtgcgcccgctc
tacgacgacggcgcctcgaaggcccaggaagccacccgcgactacgtgctgaccctcgac
gcgccgcagggccagccggcgatgctctcggtcttcggcggcaagatcaccacctatcgc
cggctggccgaatcggcgctcgaccgcctgaaggaccacctgccggcggcgcgcaaggag
ccctggacctcgggcgccgtcctgccgggcggcaacttcccgaaggagagctacgacgac
atcgtggcggggctcgcgcgccagcatcccggcgtgccggaggcgctggtcgcccggctg
gtgcgggcctacggcaccgacgcccgcgagatcctgagcggggcccgctccatggccgat
ctcggccggctgttcggcgccgacctcaccgagcgcgaggtgcgccacctgatgcgccgc
gaatgggcatcgcgcgccgaggacgtgctctggcgccgttcgaagctcggtcttagggtc
acccccgccgaggccgaagccctcgacgagttcatgcgccgcgccgccgccgcccccaac
gcggcctga

DBGET integrated database retrieval system