KEGG   Methylobacterium aquaticum: Maq22A_c12675Help
Entry
Maq22A_c12675     CDS       T04311                                 

Gene name
argE
Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00220  Arginine biosynthesis
maqu01100  Metabolic pathways
maqu01110  Biosynthesis of secondary metabolites
maqu01130  Biosynthesis of antibiotics
maqu01210  2-Oxocarboxylic acid metabolism
maqu01230  Biosynthesis of amino acids
Module
maqu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Maq22A_c12675 (argE)
Enzymes [BR:maqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Maq22A_c12675 (argE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: BAQ45774
UniProt: A0A0C6FKW7
LinkDB All DBs
Position
2432661..2433803
Genome map
AA seq 380 aa AA seqDB search
MSDAAALLSALVAIPSVCRTPNGAIVALVRDHLARHGVEAAILPGPEGDRANLFATIGPR
DVPGIVLSGHLDVVPAGEGWTGDPFALRQVGDRLVGRGAVDMKGFVACLLALVPEMVRAP
LARPIHLALSYDEEVGCVGVRHMIARLPELCATPTACLVGEPSEMRPVLRHKGKVAGRLT
VRGRAGHSSRPDLADNAVHLAADLVGLVRGLHEDFVARGPFHDMFTPASSTLQVGVIAGG
TGVNVVPDTCRIDWEARAVPGTDPMTIHDALLARVAGLVDPLRAAGREVAVESEVLSAYP
ALDLPDDAPLRSLAEAWSGHAALGAVSYGTEAGLFQAAGIPSIICGPGRIAEAHRPDESI
GLADLDECCAMLRRVIAQQS
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgccgccgccctcctgtccgccctcgtggcgatcccctcggtgtgccgcacg
ccgaacggcgcgatcgtcgcgctggtgcgcgaccacctcgcccgccacggcgtcgaggcg
gcgattctgccggggccggagggcgaccgcgccaacctgttcgcgacgatcggcccgcgc
gacgtgccggggatcgtcctgtcgggccatctcgacgtggtgccggcgggcgagggctgg
accggcgaccccttcgccctgcggcaggtcggcgaccgcctggtcgggcgcggcgccgtc
gacatgaagggcttcgtcgcctgcctgctggcgctcgtgcccgagatggtgcgggcgccg
ctcgcccggccgatccacctcgccctgtcctacgacgaggaggtcggctgcgtcggcgtg
cgccacatgatcgcccggctgcccgagctctgcgccacccccaccgcctgcctcgtcggc
gagccctcggagatgcgcccggtcctgcgccacaagggcaaggtggccggccgcctcacg
gtgcgggggcgcgccggccattcctcgcggccggatctcgccgacaacgccgtgcacctc
gccgccgacctcgtcgggctggtacgcggcctgcacgaggatttcgtcgcgcggggcccg
ttccacgacatgttcacgccggcctcctcgaccctgcaggtcggggtcatcgccggcggc
accggcgtcaacgtcgtgcccgatacctgccggatcgactgggaggcccgcgcggtgccg
ggcaccgacccgatgacgatccacgacgcgctcctcgcccgggtcgccggcttggtcgac
ccgttgcgggcggccggccgcgaggtcgcggtcgagagcgaggtcttgtcggcctatccc
gccctcgatctccccgacgacgcgcccttgcggagcctcgccgaggcgtggtcgggccac
gccgccctcggggcggtgagctacggcaccgaggccggcctgttccaggccgccggcatc
ccgtcgatcatctgcgggcccggccgcatcgccgaggcgcaccggccggacgaatcgatc
gggctcgccgacctcgacgaatgctgtgcgatgttgcgccgcgtcatcgcgcaacaaagt
tga

DBGET integrated database retrieval system