KEGG   Methylobacterium aquaticum: Maq22A_c12755Help
Entry
Maq22A_c12755     CDS       T04311                                 

Gene name
tdh
Definition
(GenBank) phosphoesterase
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
maqu  Methylobacterium aquaticum
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Maq22A_c12755 (tdh)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     Maq22A_c12755 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Methyltransf_25 Methyltransf_11 Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: BAQ45790
UniProt: A0A0C6FSK6
LinkDB All DBs
Position
2449184..2450224
Genome map
AA seq 346 aa AA seqDB search
MTLAARIHAAKDLRVETISLREPEADEVVVALGAGGICGSDLSYYGKGRVGDFSLREPMV
LGHEVAGTVTRVGKAVTGVKPGYRVAVDPSRPCLACDYCRAGRSNLCRNMRFFGSAAIFP
HVQGGFSELFLARADQCVPIPDAMPMRVAACGEPLAVALHGIRRAGELLGRHVLIAGAGP
IGLLCLMAARLAGARRIVCTDLAEAPLAIAREIGAAETINVASQPERLAAYEADKGTFDV
ALEATGAPAALASLFRVVRPGGRVVQLGMMPPGDVPVPANLLMAREIDFVGAFRFHEEYR
TAIALLASGRIDVAPILSAELPMSRADEAFALAADRSRAIKVHLAF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgccgcgcgcatccacgccgccaaggacctgcgggtcgagacgatctcgctg
cgcgagccggaggcggacgaggtcgtggtcgcactcggcgcgggcggcatctgcggctcg
gacctgtcctattacggaaagggccgggtcggggatttcagcttgcgcgagccgatggtg
ctcggccacgaggtcgccggcacggtgacgcgggtgggcaaggccgtcaccggcgtgaag
ccgggctaccgggtcgcggtcgatccgagccgtccgtgcctggcttgcgactattgccgc
gccggccgctcgaacctgtgccgcaacatgcggttcttcggctcggccgcgatcttcccg
catgtccagggcggcttcagcgagctcttcctcgcccgggccgaccagtgcgtgccgatc
cccgacgcgatgccgatgcgggtcgccgcctgcggcgagcccctggcggtggcgctccac
gggatccggcgggccggcgagctcctgggccgccacgtcctcatcgccggggccgggccg
atcggactcctgtgcctgatggcggcgcggctcgcgggggcgcgccggatcgtctgcacc
gacctcgccgaggcgccgctggccatcgctcgcgagatcggcgcggccgagaccatcaat
gtggcctcgcagcccgagcggctcgccgcctacgaggctgacaagggcaccttcgacgtc
gcgctcgaggccaccggcgcgcccgcggcgctcgcctcgctgttccgggtggtgcggccc
ggcggccgggtggtgcagctcggcatgatgccgccgggcgacgtgccggtgccggccaac
ctcctgatggcccgcgagatcgatttcgtcggcgccttccgcttccacgaggagtaccgc
accgccatcgcgctcctggcctccggccggatcgacgtcgcgccgatcctgtcggccgaa
ctgccgatgtcgcgggccgacgaggccttcgcgctcgccgccgaccgcagccgggcgatc
aaggtccacctcgccttctag

DBGET integrated database retrieval system