KEGG   Methylobacterium aquaticum: Maq22A_c16110Help
Entry
Maq22A_c16110     CDS       T04311                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00061  Fatty acid biosynthesis
maqu00780  Biotin metabolism
maqu01100  Metabolic pathways
maqu01212  Fatty acid metabolism
Module
maqu_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Maq22A_c16110 (fabA)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Maq22A_c16110 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:maqu01004]
    Maq22A_c16110 (fabA)
Enzymes [BR:maqu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     Maq22A_c16110 (fabA)
Lipid biosynthesis proteins [BR:maqu01004]
 Fatty acid synthase
  Component type
   Maq22A_c16110 (fabA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: BAQ46361
UniProt: A0A0C6F1B3
LinkDB All DBs
Position
3084322..3084786
Genome map
AA seq 154 aa AA seqDB search
MRLEYFDMIDRVVSLDREGGRLVARSTVPQESPVFEGHFPGHPLVPGVLLTETMAQASGY
LLLARASFSHMPFLMGVDKARFRTFVGPGAELEVEASLEHDGSGYAVTKAAIRAEGKPIC
NAELRFRTMPFPDGLGALMRERTARIGLPDGADS
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgaatatttcgacatgatcgaccgggtcgtcagcctcgaccgcgagggcggg
cgcctcgtcgcccggtccacggtgccgcaggagagcccggtcttcgagggacactttccc
ggtcacccgctggtgccgggcgtgctcctcaccgagacgatggcgcaggcctccgggtac
ctgctgctcgcgcgtgcgtcgttcagccacatgccgttcctgatgggcgtcgacaaggcg
cgcttccggaccttcgtcggccccggggccgagctggaggtcgaggcgagcctggagcac
gacggctcgggctatgccgtgaccaaggcggcgatccgggcggagggcaagccgatctgc
aacgccgaattgcggttccggaccatgccgttcccggatgggctcggcgcgctgatgcgc
gagcgcaccgcccggatcggcctgcccgacggagcggattcatga

DBGET integrated database retrieval system