KEGG   Methylobacterium aquaticum: Maq22A_c22860Help
Entry
Maq22A_c22860     CDS       T04311                                 

Gene name
putA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
maqu  Methylobacterium aquaticum
Pathway
maqu00010  Glycolysis / Gluconeogenesis
maqu00620  Pyruvate metabolism
maqu01100  Metabolic pathways
maqu01110  Biosynthesis of secondary metabolites
maqu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:maqu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maq22A_c22860 (putA)
   00620 Pyruvate metabolism
    Maq22A_c22860 (putA)
Enzymes [BR:maqu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Maq22A_c22860 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA LuxC
Motif
Other DBs
NCBI-ProteinID: BAQ47541
UniProt: A0A0C6F4D1
LinkDB All DBs
Position
4448883..4450406
Genome map
AA seq 507 aa AA seqDB search
MNKPEFFADAKTKSPFSARYDNFIGGQWVAPVAGRYFENTSPITGGVICEVARSDAQDIE
RALDAAHAAKEAWGRAAPAERALILTRIADRMQENLDLIALAETWDNGKPIRETTHADIP
LAIDHFRYFAGCVRAQEGSLSEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASVLLLAELIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAQDDDFLDKALEGFAMFALNQGE
VCTCPSRALVHESIYDRFIEKAVARVKAIKQGSPLDPSTMIGAQASSEQLEKILSYIDIG
RQEGAEVLTGGGRSMRDGEMSGGFYVEPTVLRGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LAIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNLLVSYSPKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcttcgccgacgccaagacgaagtccccgttctcggcccgctac
gacaacttcatcggcggccagtgggtggccccggtggcgggccgctacttcgagaacacc
tcgccgatcaccggcggcgtgatctgcgaggtcgcccgctccgacgcgcaggacatcgag
cgcgcgctcgacgccgcccacgctgccaaggaagcctggggccgcgccgcgccggccgag
cgggccctgatcctcacccggatcgccgaccggatgcaggagaatctcgacctcatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccacccacgccgacatcccg
ctcgccatcgaccatttccgctacttcgccggctgcgtccgggcgcaggagggctcgctc
tccgagatcgaccacgacaccgtcgcctaccacttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtctggaagctcgcgcccgcgctg
gccgccggcaactgcgtggtgctcaagcccgccgagcagaccccggcctcggtgctgctg
ctcgccgagctgatcggcgacctcctgcccccgggcgtgctcaacatcgtcaacggcttc
gggctcgaggccggcaagccgctcgcctcctcgccccgcatcgccaagatcgccttcacg
ggcgagaccacgaccgggcggctgatcatgcagtacgcctcgcagaacctgatcccggtg
accctggagctgggcggcaagtcgcccaacatcttcttcgccgacgtgatggcgcaggac
gacgacttcctcgacaaggcgctcgagggcttcgcgatgttcgccctcaaccagggcgag
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctacgaccgcttcatcgag
aaggcggtcgcccgggtgaaggcgatcaagcagggctcgcccctcgatccctcgaccatg
atcggcgcccaggcctcgagcgagcagctggaaaagatcctgtcctacatcgatatcggc
cggcaggagggcgccgaggtgctcaccggcggcggccgctcgatgcgcgacggcgagatg
tccggcggcttctacgtcgagcccacggtcctgcgcggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctgtcggtcacgaccttcaaggacgacgaggaggcg
ctcgccatcgccaacgacaccctctacggcctcggcgccggcgtctggacccgcgacggc
acccgcgcctaccgcttcggccgcgcgatccaggccggccgcgtctggaccaactgctac
cacgcctacccggcccacgcggccttcggtggctacaagcagtccggcatcggccgcgag
acccacaagatgatgctcgaccactaccagcagaccaagaacctgctggtcagctactcg
ccgaagaagctcggcttcttctga

DBGET integrated database retrieval system