KEGG   Microcystis aeruginosa: MAE_14790Help
Entry
MAE_14790         CDS       T00647                                 

Gene name
ntcB
Definition
(GenBank) nitrate/nitrite transport system permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mar  Microcystis aeruginosa
Pathway
mar00910  Nitrogen metabolism
mar02010  ABC transporters
Module
mar_M00438  Nitrate/nitrite transport system
mar_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mar00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    MAE_14790 (ntcB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MAE_14790 (ntcB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mar02000]
    MAE_14790 (ntcB)
Transporters [BR:mar02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    MAE_14790 (ntcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 Romo1
Motif
Other DBs
NCBI-ProteinID: BAG01301
CYORF: MAE_14790
UniProt: B0JUB3
LinkDB All DBs
Position
complement(1321659..1322486)
Genome map
AA seq 275 aa AA seqDB search
MAVSISRRSQGSKWVKDLKKKLPKLATSAIALLIFLAIWQILCFSPDAPLPSPTKVVSDT
WELIINPFFNNGGTDVGLFWQIFASLQRVAVGFTLAAIVGIAVGILIGSNALIYDAIDPI
FQILRTVPPLAWLPISLAAFRNNEPSAIFVIFITAIWPIIINTAVGVQQVPQDYKNVSRV
LKLSKVEYFFNILFPATVPYVFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSM
ISEIILALIYVGIVGFLLDRLMAYIAKLVVPEENK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggctgtttctatttctcgtcgttctcaaggttcaaaatgggtaaaagacctgaaaaaa
aaattacccaaactagcaacttcggcgattgctttattaattttccttgccatctggcaa
atactctgttttagtcccgatgcccccctccctagtcccactaaagtggttagcgatacc
tgggaattaattattaatcccttcttcaataatggtggcacggatgtggggttattctgg
caaattttcgccagtttacaacgggtggccgtcggttttaccctagccgctattgtcggc
atcgccgtaggaattttaatcggtagtaacgccctaatttatgatgcgatcgatccgatt
ttccaaatcctgcgtaccgttccccccctagcttggctacccatctccctagcggctttt
cgtaataacgaacctagtgccatatttgtaatttttattacagcaatttggccaattatt
attaacacggccgtgggagtacagcaggttccccaagactataaaaacgtctctagagtg
ctaaaattatccaaagttgaatactttttcaatattctttttcccgctactgttccctac
gttttcacgggattaagaatcggtatcggtttatcttggttggcgattgtagcggcggaa
atgctgatcggtggcgtgggaattggcttctttatctgggatgcttggaatagttccatg
atcagtgaaattatcctcgccctgatttatgtgggtattgttggtttcttactcgatcgc
ctcatggcctacatcgctaaattagttgtacccgaagaaaataaatag

DBGET integrated database retrieval system