KEGG   Microcystis aeruginosa: MAE_47870Help
Entry
MAE_47870         CDS       T00647                                 

Gene name
rbcS
Definition
(GenBank) ribulose bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mar  Microcystis aeruginosa
Pathway
mar00630  Glyoxylate and dicarboxylate metabolism
mar00710  Carbon fixation in photosynthetic organisms
mar01100  Metabolic pathways
mar01120  Microbial metabolism in diverse environments
mar01200  Carbon metabolism
Module
mar_M00165  Reductive pentose phosphate cycle (Calvin cycle)
mar_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
mar_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:mar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MAE_47870 (rbcS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MAE_47870 (rbcS)
Enzymes [BR:mar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MAE_47870 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: BAG04609
CYORF: MAE_47870
UniProt: B0JVL6
LinkDB All DBs
Position
complement(4389548..4389883)
Genome map
AA seq 111 aa AA seqDB search
MKTLPKEKRYETLSYLPPLTDQQIAKQIQYMIDQGYIPAVEFEKDPKPADYHWTMWKLPL
FSVSGPQEVLNEVRECRTEYSDCYIRVIAFDNIKQCQTMSFIVHKPNAGRY
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacctaaagagaagcgttacgaaactctttcctacttgccccccctcacc
gatcaacaaattgctaaacaaattcaatacatgatcgatcagggttatattcctgctgtg
gaatttgaaaaagatcccaaacccgcggattatcattggacgatgtggaaactgccttta
ttctctgtttctggtccccaagaagttcttaatgaagttcgcgagtgccgcaccgagtat
tctgattgctacatccgcgttatcgcttttgacaacatcaaacaatgtcaaaccatgagc
tttattgttcataaacccaatgccggccgctactaa

DBGET integrated database retrieval system