KEGG   Microcystis aeruginosa: MAE_57060Help
Entry
MAE_57060         CDS       T00647                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
mar  Microcystis aeruginosa
Brite
KEGG Orthology (KO) [BR:mar00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    MAE_57060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: BAG05528
CYORF: MAE_57060
UniProt: B0JHW6
LinkDB All DBs
Position
complement(5266703..5267461)
Genome map
AA seq 252 aa AA seqDB search
MADNYLILLITGVFSGLLAGLFGIGGGTISVAILLNLGYSYGESVATSSLAIVFTSLGGT
IQNWRLGSLKWQRVLLLGLPGIFTAFIGVYLVKYSPKHLLEAAFGCFLLLNIYLTNLKQN
LSQKESVSAIRLHPNLACLLTGGIAGFLAGIFGIGGGAIMVPLQMIFLAEKIKIAIVTSL
GVVLLNSIAACFAHAQAGHILYLQGIILGIGGSLGVQVTTRFLPKLPDRLVRITFYIFLL
LMAIYFFIRACS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaattacttgattttactgataacaggcgttttttcgggcttattagcgggt
ttattcggtattgggggtggcactatctccgtggcgatcctgttaaatttgggctacagt
tacggggaatcggtggctaccagcagtttagcgatcgttttcacttccctagggggtacg
atccaaaattggcgattaggttccctgaaatggcagcgagttctcctcttaggtttaccc
gggatttttacggcatttatcggggtctatctggtcaaatatagccccaaacacctccta
gaagcggcttttggttgttttttactgctcaatatctatttaaccaatctcaagcaaaat
ttaagccaaaaagagtcagtttctgccattagattgcatcctaatctagcctgtctgcta
accggaggaatcgctggatttctagccggtattttcggaattggcggtggggcgatcatg
gtgccactacaaatgatttttttggcagaaaagatcaaaatcgccattgtcaccagttta
ggtgtggttttactcaattcgatcgccgcctgtttcgctcatgcccaagccggtcatatt
ctttatctacaagggattattttaggtatcggtggttccctaggtgtacaagtaaccact
cgttttttaccgaaattaccggatcgattggtgcggattactttttatatttttctgcta
ctgatggccatttatttcttcatccgcgcttgctcttag

DBGET integrated database retrieval system