KEGG   Microcystis aeruginosa: MAE_59640
Entry
MAE_59640         CDS       T00647                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mar  Microcystis aeruginosa
Pathway
mar00010  Glycolysis / Gluconeogenesis
mar00020  Citrate cycle (TCA cycle)
mar00620  Pyruvate metabolism
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01120  Microbial metabolism in diverse environments
mar01200  Carbon metabolism
Module
mar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_59640
   00020 Citrate cycle (TCA cycle)
    MAE_59640
   00620 Pyruvate metabolism
    MAE_59640
Enzymes [BR:mar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MAE_59640
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: BAG05786
CYORF: MAE_59640
UniProt: B0JJ78
LinkDB
Position
complement(5494500..5495759)
AA seq 419 aa
MIRDIFMPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVIL
VEAGQEAPVGEAIAYIAETEAEIELAKAQGKTATAAPSKPVETPEIAPPPVSIPVAAVKD
NGRLVASPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVS
VPVAAPKAPIPASAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQL
KSKGVTMTALLAKAVANTLAKHPIVNASYSDAGIQYHGAINVSVAVAMPGGGLITPVLRS
ADQMDIYSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAIL
AVGASRPQIVVNKDGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgattcgagatatcttcatgcccgcgctcagttccaccatgaccgaaggaaaaatagtt
tcttgggtgaagtcccccggggaaaaagtcagcaaaggggaaacggtgttagtggtcgaa
tccgacaaagccgacatggacgtagaatcgttttatgatggctatctcgctgtaatttta
gtcgaagccggccaggaagcacccgtgggggaagcgatcgcctatatcgccgaaactgaa
gcggaaattgaactggccaaagctcagggaaaaaccgccacagctgcccctagcaagccc
gtagagaccccagaaatcgctccgcctcccgtttcgatacccgtcgccgccgttaaagat
aatggccgtttagtcgcctctcccagggccaaaaaactggctaaagaattaaaggtagat
ctgaaaaccctagtgggtagcggtccccacggacgaattaccgccgaagacgtagaaaaa
gcgacaggaaaagtcagcaccgcccccgctcccgtcattactcccccgcaacccgtcagc
gtgcctgtagcggctcctaaagccccgattccggccagcgccccggtcggtcggactgtt
cccctcaccactctgcaaaaagccgtcgcccagaatatgtcggttagcctacaggttccc
accttccaagtgggctacactatcaccactgacccactggatcaactctatcaacagcta
aaatccaagggtgtcaccatgacggccctgttagcaaaagcggtagccaacaccctcgct
aaacatcctatagttaatgccagctatagcgacgcaggaatccaataccacggggcgatt
aacgtgtccgtagccgtagctatgcctggtggtggcttaattacgccggttttgcgctct
gctgaccagatggatatctattccctctcccgcagttggaaagatttagtcgatcgcgcc
cgcagtaaacaactgcaaccggaagaatataatagcggtacttttaccatttctaatctg
ggaatgttcggagtcgatcgctttaccgctatcttaccccccaaccaaggtgcgatccta
gccgtgggtgcttcccgtccccaaatcgtcgtcaataaagatggtttattcggagtgcaa
aaacagatgacggttaatctcaccagtgaccaccgagtcatctacggggccgatgcagcc
tccttcctgcaagacttagctaaactgatcgaaactgaggtgcagtctttaactatgtaa

DBGET integrated database retrieval system