KEGG   Microcystis aeruginosa: MAE_59640Help
Entry
MAE_59640         CDS       T00647                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mar  Microcystis aeruginosa
Pathway
mar00010  Glycolysis / Gluconeogenesis
mar00020  Citrate cycle (TCA cycle)
mar00620  Pyruvate metabolism
mar01100  Metabolic pathways
mar01110  Biosynthesis of secondary metabolites
mar01120  Microbial metabolism in diverse environments
mar01130  Biosynthesis of antibiotics
mar01200  Carbon metabolism
Module
mar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAE_59640
   00020 Citrate cycle (TCA cycle)
    MAE_59640
   00620 Pyruvate metabolism
    MAE_59640
Enzymes [BR:mar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MAE_59640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Ribosomal_L18p Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: BAG05786
CYORF: MAE_59640
UniProt: B0JJ78
LinkDB All DBs
Position
complement(5494500..5495759)
Genome map
AA seq 419 aa AA seqDB search
MIRDIFMPALSSTMTEGKIVSWVKSPGEKVSKGETVLVVESDKADMDVESFYDGYLAVIL
VEAGQEAPVGEAIAYIAETEAEIELAKAQGKTATAAPSKPVETPEIAPPPVSIPVAAVKD
NGRLVASPRAKKLAKELKVDLKTLVGSGPHGRITAEDVEKATGKVSTAPAPVITPPQPVS
VPVAAPKAPIPASAPVGRTVPLTTLQKAVAQNMSVSLQVPTFQVGYTITTDPLDQLYQQL
KSKGVTMTALLAKAVANTLAKHPIVNASYSDAGIQYHGAINVSVAVAMPGGGLITPVLRS
ADQMDIYSLSRSWKDLVDRARSKQLQPEEYNSGTFTISNLGMFGVDRFTAILPPNQGAIL
AVGASRPQIVVNKDGLFGVQKQMTVNLTSDHRVIYGADAASFLQDLAKLIETEVQSLTM
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgattcgagatatcttcatgcccgcgctcagttccaccatgaccgaaggaaaaatagtt
tcttgggtgaagtcccccggggaaaaagtcagcaaaggggaaacggtgttagtggtcgaa
tccgacaaagccgacatggacgtagaatcgttttatgatggctatctcgctgtaatttta
gtcgaagccggccaggaagcacccgtgggggaagcgatcgcctatatcgccgaaactgaa
gcggaaattgaactggccaaagctcagggaaaaaccgccacagctgcccctagcaagccc
gtagagaccccagaaatcgctccgcctcccgtttcgatacccgtcgccgccgttaaagat
aatggccgtttagtcgcctctcccagggccaaaaaactggctaaagaattaaaggtagat
ctgaaaaccctagtgggtagcggtccccacggacgaattaccgccgaagacgtagaaaaa
gcgacaggaaaagtcagcaccgcccccgctcccgtcattactcccccgcaacccgtcagc
gtgcctgtagcggctcctaaagccccgattccggccagcgccccggtcggtcggactgtt
cccctcaccactctgcaaaaagccgtcgcccagaatatgtcggttagcctacaggttccc
accttccaagtgggctacactatcaccactgacccactggatcaactctatcaacagcta
aaatccaagggtgtcaccatgacggccctgttagcaaaagcggtagccaacaccctcgct
aaacatcctatagttaatgccagctatagcgacgcaggaatccaataccacggggcgatt
aacgtgtccgtagccgtagctatgcctggtggtggcttaattacgccggttttgcgctct
gctgaccagatggatatctattccctctcccgcagttggaaagatttagtcgatcgcgcc
cgcagtaaacaactgcaaccggaagaatataatagcggtacttttaccatttctaatctg
ggaatgttcggagtcgatcgctttaccgctatcttaccccccaaccaaggtgcgatccta
gccgtgggtgcttcccgtccccaaatcgtcgtcaataaagatggtttattcggagtgcaa
aaacagatgacggttaatctcaccagtgaccaccgagtcatctacggggccgatgcagcc
tccttcctgcaagacttagctaaactgatcgaaactgaggtgcagtctttaactatgtaa

DBGET integrated database retrieval system