KEGG   Marinobacter sp. Arc7-DN-1: D0851_00180Help
Entry
D0851_00180       CDS       T05619                                 

Definition
(GenBank) hypothetical protein
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00010  Glycolysis / Gluconeogenesis
mara00030  Pentose phosphate pathway
mara00051  Fructose and mannose metabolism
mara00052  Galactose metabolism
mara00680  Methane metabolism
mara01100  Metabolic pathways
mara01110  Biosynthesis of secondary metabolites
mara01120  Microbial metabolism in diverse environments
mara01130  Biosynthesis of antibiotics
mara01200  Carbon metabolism
mara01230  Biosynthesis of amino acids
Module
mara_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    D0851_00180
   00030 Pentose phosphate pathway
    D0851_00180
   00051 Fructose and mannose metabolism
    D0851_00180
   00052 Galactose metabolism
    D0851_00180
  09102 Energy metabolism
   00680 Methane metabolism
    D0851_00180
Enzymes [BR:mara01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     D0851_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: AXS81618
UniProt: A0A346RW92
LinkDB All DBs
Position
complement(23665..24330)
Genome map
AA seq 221 aa AA seqDB search
MKGRHRFYTGAQYEVSGVGPMVSTAQWEHLLDQFETHCSEGLGVITGSLQQGLPKDLYAE
AVRRVRASGGRAVVDSHNELLLHAIKAQPFLIKPNRFELEALVGQPLTNQQNIVREARQL
QERGVTWVCVSMGAEGALLVTSSSVLKGEAPSVPVISTVGAGDSMVAGMAGLLAQGAADR
DALREGIACSAATVMQPGTELFDKETVDRLRGEVRVTQLSM
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaagggacgtcaccggttttatacgggtgcccagtatgaggtcagtggtgtcggccct
atggtgtcgaccgcacaatgggaacacttgctcgaccaattcgagacccattgcagtgag
gggctgggggttatcaccggctcgttacagcagggcttgccgaaggacctgtatgccgag
gcggtgcgtcgggtgcgggcatccggggggcgtgcggtcgtcgactcgcacaatgagctg
ctactgcacgcgatcaaagcccaacctttcctgattaagcccaaccgtttcgaattggaa
gccctggtcgggcagcctctgacgaatcaacagaatatcgttcgggaagcccgccagttg
caggagcggggcgtgacctgggtctgcgtctctatgggggctgagggtgcgttgctggtg
acgtcgtcaagtgtccttaaaggcgaagcgccttcggtccccgtgatctccacggtcggg
gccggtgattcgatggtggccggtatggcggggctattggcgcagggcgcggcggaccgg
gatgcgttacgtgagggcattgcctgcagcgcggcaacggtgatgcagccagggaccgag
ttgttcgataaggaaacggttgatcggctgcgtggtgaggttcgggtgacgcagctttcg
atgtga

DBGET integrated database retrieval system