KEGG   Marinobacter sp. Arc7-DN-1: D0851_05125Help
Entry
D0851_05125       CDS       T05619                                 

Definition
(GenBank) SDR family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00061  Fatty acid biosynthesis
mara00780  Biotin metabolism
mara01100  Metabolic pathways
mara01130  Biosynthesis of antibiotics
mara01212  Fatty acid metabolism
Module
mara_M00083  Fatty acid biosynthesis, elongation
mara_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D0851_05125
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D0851_05125
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    D0851_05125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mara01004]
    D0851_05125
Enzymes [BR:mara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     D0851_05125
Lipid biosynthesis proteins [BR:mara01004]
 Fatty acid synthase
  Component type
   D0851_05125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N NAD_binding_2 Methyltransf_25 YjeF_N Ubie_methyltran
Motif
Other DBs
NCBI-ProteinID: AXS82467
UniProt: A0A346RYP1
LinkDB All DBs
Position
1103149..1103910
Genome map
AA seq 253 aa AA seqDB search
MKLQDSVIAITGGGQGLGRAMAEHLASKGTKVALIDLMPEKLDEAVAACKAAGSEAKSYI
CNVAKEEDVEKTFEAIIKDFGHLNGLINNAGILRDCLMVKAKECKVERRMELSQWQAVID
VNLTGVFLCGREAATRMIKNGDQGVIINIASISRAGNMGQSNYSAAKAGVSALVPVWARE
LARHGIRCAGIAPGFIETEMTASMKPEVLEKMIAGIPLKRMGKPEEIASAAAFIFENDYV
SGRMLEVDGALRL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcaagattccgtgattgcgattaccggtggcggccagggtctgggccgtgcc
atggctgaacaccttgcctccaaaggcacaaaagtcgcgttgatcgacctgatgccggaa
aaactggacgaagccgtcgccgcctgcaaagccgccggttcagaggcaaaaagctacatt
tgcaacgtggcgaaagaagaagacgtcgagaaaaccttcgaagccatcatcaaagacttc
ggccacctcaatggtctgatcaacaacgccggcatcctccgcgactgcctgatggtcaaa
gccaaagagtgcaaagttgagcggcgcatggaactgtcccagtggcaggccgtgatcgac
gtcaacctcaccggcgtcttcctctgcggccgcgaagccgccacccggatgatcaagaac
ggcgaccagggtgtgatcatcaacattgcctccatctcccgcgccggcaacatgggccag
agcaactactccgccgccaaagccggcgtctccgccctggttccggtctgggccagggaa
ctcgcccgccacggcatccgctgtgcaggcatagctccgggctttatcgaaaccgaaatg
accgcctccatgaaaccggaagtcctggaaaaaatgatcgccggcattccgctcaagcgc
atgggcaaaccagaagaaatcgcctcggcggcggcgtttatctttgagaatgactatgtg
tccgggcgtatgcttgaggtggatggggctctgaggctgtaa

DBGET integrated database retrieval system