KEGG   Marinobacter sp. Arc7-DN-1: D0851_05880Help
Entry
D0851_05880       CDS       T05619                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00970  Aminoacyl-tRNA biosynthesis
mara01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mara00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D0851_05880 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mara03029]
    D0851_05880 (gatB)
Enzymes [BR:mara01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     D0851_05880 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     D0851_05880 (gatB)
Mitochondrial biogenesis [BR:mara03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    D0851_05880 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AXS82602
UniProt: A0A346RZ26
LinkDB All DBs
Position
1260269..1261720
Genome map
AA seq 483 aa AA seqDB search
MQWDIVIGLEIHVQLATRTKIFSGSSTAYGAEPNTQANAVDLAMPGTLPVPNEQAFRYAV
MFGLAVNAEIERRSVFERKNYFYPDLPKGYQTTQLERPIVGPGYVDIDLANGETRRVRIH
HAHLEEDAGKSLHEDFHGMTGVDLNRAGTPLIEVVTEPDMNNAEEAVAFAKKLHGIVTSL
GICDGDMSQGSMRFDVNISLKPKGSDTLGTRTETKNLNSFRFMEQAIAHEVERQMDILED
GGRIVQETRLYNGDRDKSRSMRTKEEANDYRYFPCPDLLPVEIDDSFISEARNRLPELPD
ARKARFKDQYGLNDYDAGLLSGDSKLATFFEEAASHGKDAKLVANWIQGEFSARLNAEEK
TVADSPITGAQLGDLVVRIADNTVSSAGAKKVFEALWSGENDNVDAIIDAKGLKQVSDTG
ALEAMVDEVLAGMPDQVAQYQQESDPKKQKKMLGGFMGPLMKASKGQGNPKLFNEILVRK
LGG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgggacattgtgatcgggctggaaattcacgttcagctcgccacccgaaccaag
atcttttccggctccagcaccgcctacggcgccgagcccaacacccaggccaacgccgtt
gacctggccatgcccggcaccctgcccgtgcccaacgagcaggccttccgctacgcggtg
atgtttggcctggcggtgaacgccgagattgaacgccgctcggtgttcgaacggaaaaac
tatttctacccggatctgccgaagggctaccagaccacccagctggagcgtccgatcgtc
ggccccggctacgtggacattgatctggccaacggtgagacccggcgcgtgcgcattcac
cacgctcacctggaagaagacgccggcaaatccctccatgaggatttccacggcatgacc
ggcgtggatctcaaccgggccggcacgccactgatcgaagtggtcaccgaaccggatatg
aataatgccgaggaagccgtggcgttcgccaagaaactgcacggcattgtaacctcgctg
ggtatctgcgatggcgacatgtcccagggctccatgcgcttcgacgtgaacatctccctg
aagccaaaaggctcggacaccctcggcacccgcaccgaaaccaagaacctgaactcattc
cgattcatggaacaggccattgcccacgaagtggaacgacagatggacatcctggaagac
ggcggcagaattgtgcaggaaacccgcctgtacaatggcgaccgggacaaatcccgctcg
atgcgcaccaaggaagaagccaacgactaccgctacttcccctgcccggacctgctgccg
gtggaaattgatgactcgttcattagcgaagcccgcaaccgcctcccggaactgccggat
gcacggaaggcacggttcaaggaccagtacggcctgaacgactacgacgccggcctgctc
agcggcgactccaaactggccacgttcttcgaggaagccgccagccacggcaaagacgcc
aagctggtcgccaactggatccagggcgaattttccgcccgcctgaatgccgaggagaag
accgttgccgactcccccatcaccggcgcccagttgggtgacctggtggtgcggattgcc
gataacacggtttcctctgctggcgcaaagaaggtgtttgaagcgctgtggtctggcgaa
aacgacaacgtggacgcgatcatcgacgccaagggcctgaagcaggtgtctgacaccggt
gcgctggaagccatggtagacgaggtgctggccgggatgccggatcaggtggcccagtat
cagcaggaatccgatcccaagaaacagaagaagatgcttggcgggtttatggggcctcta
atgaaggcctccaagggtcagggaaatcccaagctgtttaacgagattctggttcgcaag
cttggggggtaa

DBGET integrated database retrieval system