KEGG   Marinobacter sp. Arc7-DN-1: D0851_12895Help
Entry
D0851_12895       CDS       T05619                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mara  Marinobacter sp. Arc7-DN-1
Brite
KEGG Orthology (KO) [BR:mara00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D0851_12895
Enzymes [BR:mara01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     D0851_12895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO K_oxygenase AlaDh_PNT_C FAD_binding_3 Glutaredoxin DUF2190 Thi4 FMO-like NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AXS83839
UniProt: A0A346S2L3
LinkDB All DBs
Position
2741024..2742610
Genome map
AA seq 528 aa AA seqDB search
MLDANIKEQLTAYMDKLQQPIELVAAYDDSKKSQELQELLEELEPMSSKISLRTEESDGV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQEVIEQIQSLEGKFE
FETYFSLSCQNCPDVVQALNLMSVLNPDIKHTSIDGALFQDEVEQREVMAVPSVYLNGEP
WGQGRMTLEEIVARLDTSSSEKEAEKINQKDTFEVLVIGGGPAGASAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVKEYDVDIMNMQRAEKLIPASRPG
MPHEIRLENGATLKARSLVLSTGARWRQMGVPGEAEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGSGMRADDVLQKKLRSLKNVEIITSGQTTEITGE
NGKVNGLNYTDRNSGEQHHVALEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGIFAAGDVTTVPYKQIVISMGEGSKAALSAFDFLIRNSVDDSESEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatatcaaggaacaactgacggcgtacatggacaagctgcagcagccg
atcgagctggtggcagcttacgacgacagcaagaagtcccaggaacttcaggagctgctg
gaagagctggaaccgatgtcttccaaaatcagcctgcgcaccgaagaatccgatggtgtg
cgtcgtccttccttcgccatcaaccgtgtgggtaccgatattggcgttcgttttgccggc
attcccatgggccacgagttcacctcgctggttctggcgctgctgcaggtgggtgggcac
ccgtccaaggcttcccaggaggtgattgagcagattcagtcactggaaggcaagttcgag
tttgaaacctatttctccctgtcctgccagaactgcccggatgtggttcaggccctgaac
ctgatgagcgtgctgaacccggatatcaagcacacctccatcgacggtgccctgttccag
gacgaagtggagcagcgggaagtgatggcggtgcccagcgtttacctgaatggtgagccc
tggggtcagggccggatgacgctggaagagatcgttgccaggctggacaccagctccagc
gaaaaagaggccgaaaaaatcaatcagaaagacacctttgaggttctggtgattggtggt
ggccctgccggtgcctctgccgccatttacgctgcccgcaaaggcatctctaccggtatt
gccgccgagcgttttggtggccaggtggccgacaccatgggcatcgaaaacctgatctcc
gtgccttacaccgagggcccgaagctggtggcggccatggagcagcacgtgaaagagtat
gacgtcgatatcatgaacatgcagcgcgccgagaagctgatcccggcctcacgcccgggc
atgccccacgagattcgactggaaaatggcgcgaccctcaaggcacgcagcctggtgctg
tccaccggtgcccgctggcgccagatgggcgtgccgggcgaagcggaataccgcaacaag
ggcgtcgcctattgcccgcactgtgacggccccctgttcaagggcaagcgtgttgccgtg
atcggtggtggtaattccggtgtagaggcagccatcgacctggccggtatcgttggccac
gtgactctgatcgagttcggttccgggatgcgcgcggatgacgtattgcagaagaaactg
cgcagcctgaagaatgtggaaatcatcacttccggacagaccactgaaattactggtgag
aacggtaaggtcaacggcctgaactatacggatcgcaactccggcgagcagcaccacgtc
gcgttggaaggtgtgttcgtgcaaatcggcctggttccgaacaccgagtggctgaagggg
gacatcgagctgagccagcatggcgagattattgtcaatgatcgcaacgagacctccatt
ccggggatctttgccgccggcgatgtcaccactgtgccctacaagcagatcgtgatttcc
atgggcgagggttccaaggcagctctgagcgccttcgacttcctgatccgcaattccgtg
gatgacagcgagagcgaagcggcgtaa

DBGET integrated database retrieval system