KEGG   Marinobacter sp. Arc7-DN-1: D0851_17740Help
Entry
D0851_17740       CDS       T05619                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mara  Marinobacter sp. Arc7-DN-1
Pathway
mara00620  Pyruvate metabolism
mara00680  Methane metabolism
mara01100  Metabolic pathways
mara01120  Microbial metabolism in diverse environments
mara01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mara00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D0851_17740
  09102 Energy metabolism
   00680 Methane metabolism
    D0851_17740
Enzymes [BR:mara01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     D0851_17740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXS84700
UniProt: A0A346S524
LinkDB All DBs
Position
3773375..3776020
Genome map
AA seq 881 aa AA seqDB search
MTELHPDLRENVRMLGELLGQSIRRHPGQDCYELIEEIRAAAKADRLHESGSGQRLVSLL
GKLRDDELLPVTRAFNQFLNLANLAEQYHGIRRKRGHQSDLMVESLGEVFDRLKTGGVSP
EELHQRVADLRIEFVLTAHPTEVARRTLIMKYDEMSDCLARLDHEDLMPAESEEIANRLS
QLVTEAWHTDEIRHERPTAVDEAKWGFAVIENSLWQALPQFLRSLDTSLQEATGRGLPLQ
ASPIRIASWMGGDRDGNPNVTHKVTRKVFLLGRWMAADLYLRDIQALRAELSMWQASDEL
KAVAGDSREPYRHVLAELRDWLIKTRDWAEASVNGEPADATGILFENEDFTGPLELCYRS
LVDCGLEAIANGPLLDTIRRAHTFGLPLIRLDIRQEAARHAEAVAEMVDYVGLGDYLSWS
EQERQSFLVQELQGRRPLVPRNWEPSESVGEVLATCEVVAQQTPQALGSYVISMASKPSD
VLSVILLLRESGMKYPMRVVPLFETLDDLRGAPESMAALYEVEWYREYCQGRQEVMIGYS
DSSKDAGQLMAAWAQYQAQEKLTHVASQYGVHLTLFHGRGGTVGRGGGPANRAILSQPPG
SVNGSFRITEQGEMIRFKFGLPRLAVQSLTLYTTAVIEATLAPPPKPEDSWRETMDWLTE
RSLKAYRDVVRENPDFVPYFRQVTPEQALGKLALGSRPARRKATGGVESLRAIPWIFAWT
QMRLMLPSWLGSDVALEEAARDNRLPVLRDMMHGWPFFRTYVDMLEMVLAKADLRIASYY
EQTLLDDDKLKALGKSLRIRLQGCIQRLLELKEQNDLLEGEPVFAHSMRVRNPYTDPLHY
LQAELLRRDRESEGKGEVPELVERALKVTMAGISAGMRNTG
NT seq 2646 nt NT seq  +upstreamnt  +downstreamnt
gtgactgagctacatccggatctcagagaaaacgtgcgaatgttgggcgagctgctgggc
cagagcatacgacgacaccccgggcaggattgttatgagctgatcgaggaaatccgggcc
gctgccaaagcggaccgcctgcacgaaagcggctctggccagcggctggtgagcttgctg
ggtaagctgcgcgatgacgaactcctgccggttacccgggccttcaaccagtttctcaac
ctcgccaacctggccgagcagtaccatggtataagacgcaaacgggggcatcagtctgat
ctgatggttgaatccctgggtgaggtcttcgatcggctgaaaaccggaggtgtcagcccg
gaggaactccaccagcgagttgccgatctgcggatcgagtttgtgctgaccgctcacccc
accgaagtggcccgccgcacactgatcatgaaatacgacgaaatgtcggattgcctggcg
aggctggatcacgaggacctgatgcccgcggagagcgaggaaattgccaaccgcctgtcc
cagctggttacggaagcctggcataccgacgagattcgccatgagcggccaacggccgtg
gatgaagccaaatggggttttgcggtgatcgagaacagcctctggcaggcgttaccacag
tttctgagaagcctcgacacttctttgcaggaggctacgggtagagggctgcccttgcag
gcgtctcctatccggattgcgtcctggatggggggagaccgcgatggcaatcccaacgtg
acccataaagtgacccgcaaggttttcctgctgggccgctggatggcagcggatctctat
cttcgggatattcaggcgctgcgggccgaactgtccatgtggcaggcgagcgatgagctc
aaggcagttgccggtgattcccgggaaccctatcgccatgtcctcgccgaactccgtgac
tggctgattaaaacccgtgactgggccgaggcgagcgttaacggcgaaccggcagatgcc
accggtattctgttcgagaacgaggactttaccgggcccctggagctttgttaccggtct
ctggtcgattgcggcctggaggcgattgccaacggcccgctgctggacaccattcgccgg
gcacacaccttcggcctgccactgattcggctggatattcgccaggaagcggcccgtcac
gccgaagccgttgcagaaatggtggattatgtcggtctgggggattacctgtcctggtct
gaacaggagcgtcagtcgtttctggtgcaggagctccagggtcggcggccactggtaccc
cgcaactgggaaccctcggagtcggttggggaggtacttgccacctgcgaagtcgtagcc
cagcaaacgccccaggctctgggctcctatgtgatttccatggccagcaagccttctgat
gtgctcagcgtcattctgctgctgcgggaatcgggaatgaagtacccgatgcgtgtggtg
cccctgtttgaaaccctggacgacctgcgtggtgcccctgagagcatggctgcgctgtat
gaggtggagtggtatcgggagtattgccagggccgccaggaagtcatgattggttactcc
gattcctccaaggatgccggtcagctcatggccgcctgggcgcagtatcaggcccaggaa
aagctcacccacgttgcaagccagtatggtgtgcatctcactctgttccacggccgcggt
ggcaccgtgggccgtggtggtggcccggccaaccgggccatcctgtcccagccgccgggt
tcggtaaacggcagtttccggattaccgagcagggtgaaatgatccgtttcaagttcggt
ttgcccaggctggcggtgcagagcctgacgctctacaccacggcggttattgaagcgacc
ctggcgccgccgccgaagccggaggacagctggcgggaaaccatggactggctcacggag
cgctccctgaaggcctatcgggatgtggtccgtgagaatccggactttgtaccttatttt
cgccaggtaacgccggagcaggcgttgggaaaactggcacttggaagccggccggcgcga
agaaaggcgaccggcggcgtggaaagcctgcgggccattccctggattttcgcctggacc
cagatgcggctgatgctgcccagctggctgggcagtgatgtggcgctggaagaggcggca
cgggataaccggctcccggtcctcagggatatgatgcatggctggcctttcttccgcacc
tatgtggatatgctggagatggtgctggccaaggcagatttgcgcatcgccagctattat
gagcagacgttgctggacgatgacaaactcaaggccctcgggaaaagcctgagaatacgg
cttcagggctgcattcagcggcttctggagctcaaggaacagaacgacttgctggaaggt
gagccggtgttcgcgcattccatgcgggtgcgtaatccctacacggatcctttgcattat
ctgcaggccgagttgctccgacgtgaccgggaaagtgaaggcaagggcgaagtgccggag
ttggtggagcgtgccctgaaagtcacgatggctggcatctcggccggcatgcgcaacacc
ggctaa

DBGET integrated database retrieval system