KEGG   Maribacter cobaltidurans: CJ263_08770Help
Entry
CJ263_08770       CDS       T05023                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
marb  Maribacter cobaltidurans
Pathway
marb00240  Pyrimidine metabolism
marb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marb00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CJ263_08770
Enzymes [BR:marb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CJ263_08770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: ASV30300
UniProt: A0A223V592
LinkDB All DBs
Position
complement(2015092..2015736)
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNHKEQFGWIEVIAGSMFSGKTEELIRRLKRAQFAKLKVEIFKPMVDTRYDDDM
VVSHDANEIRSTPVPAAANIRILADTCDVIGIDEAQFFDDEIVTVCNDLANKGVRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAICTRTGNLANYSFRKSNNDKLVMLGETNEYEP
LSRGAFYKALLKQKVKGMEVDVEEIKYPNKKSNA
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaataccgttaaccacaaggaacagttcggctggatcgaagtcatagcc
ggctccatgttttcgggaaaaaccgaggaattgatacgtagattgaaaagggcccagttc
gccaaacttaaggtagagatatttaaacccatggtagatacccggtatgatgatgacatg
gtggtttcccatgacgccaacgaaatccgttctactcctgtacctgccgcagctaacatt
cgaatcttagcggacacctgcgatgtcattggtatagacgaagcacaatttttcgatgac
gaaatcgttactgtttgtaatgatctggccaataaaggagttcgggtaattgtagcaggg
ttggacatggactttaagggaaatccttttggtcccatgcccgcactaatggctacagcg
gaatatgtaaccaaggtacacgccatttgtacccgaacgggaaatctggccaattatagt
tttagaaaatccaacaatgataaattggtaatgctaggcgaaaccaacgaatatgaaccc
ctaagtagaggtgccttttacaaggctctgttaaaacaaaaggtaaagggcatggaggta
gatgtggaggaaatcaaatatcctaataagaaatccaatgcctga

DBGET integrated database retrieval system