KEGG   Maribacter cobaltidurans: CJ263_13925Help
Entry
CJ263_13925       CDS       T05023                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
marb  Maribacter cobaltidurans
Pathway
marb00380  Tryptophan metabolism
marb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    CJ263_13925 (kynU)
Enzymes [BR:marb01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     CJ263_13925 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ASV31223
UniProt: A0A223V727
LinkDB All DBs
Position
3155644..3156915
Genome map
AA seq 423 aa AA seqDB search
MKFENTLEFAQELDKRDPLAKYRNEFVYPKVKGKEVIYFTGNSLGLQPKRSKEFVDEIMK
DWAELAVEGHFYANRPWWDYHERLANPLAKVVGARPEEITVMNTLSVNLHLLMVSFYTPN
PKRYKIVCEEKAFPSDQYMLQSQVRFHGFDPENAIVEVKKREGEHYWRTEDILAKIDEVG
DELALVLIGGVNYYNGQVMDMKAITEAGKAVGANVGWDLAHAVGNVALELHDWNADFAAW
CSYKYMNSGPGNASGVFIHERHLNRKDIPRFEGWWGTKKEERFLMKPQFEPMSNADAWQI
SNPPVLSLAPYLASLELFEEVGMQALIEKQKSITSYLEFVLGEIDKDVDSSFEIITPQER
GCQLSVFLHGQGKVLFNYLMDHGVIVDWREPNVIRLAPAPFYCSFEEMYRFGQILKEGIL
NKD
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttgaaaataccctggaatttgcccaagaattggataaaagggacccattggcc
aaataccgcaatgagtttgtctatcctaaggtaaaaggtaaagaggttatttatttcaca
ggaaattctttgggactacaaccaaaacgctctaaagaatttgtggacgagattatgaag
gattgggccgaattggccgtagagggacacttttatgcaaacagaccatggtgggactat
catgagcggctagccaatcctttggccaaagtggtaggcgcccgccctgaagaaatcacc
gtgatgaacactttgagcgtaaatctccatttgcttatggtttccttttataccccaaat
ccaaaacggtacaaaatagtatgtgaggaaaaggcatttcccagtgatcaatatatgctc
caaagtcaagtaaggtttcatggttttgaccctgaaaatgccatcgttgaggttaaaaaa
cgggagggtgagcattattggaggactgaggatattctggctaaaattgatgaagtaggg
gatgagcttgccctggtcctgattggtggcgttaattattataatggacaggttatggat
atgaaggcgattaccgaggctggtaaggccgttggggcaaatgtgggttgggacctggcc
catgccgttggtaacgttgcgcttgaactccatgattggaatgccgattttgccgcatgg
tgcagttataagtacatgaacagtgggcctggaaatgcatcaggcgtatttatacatgaa
agacatttgaacagaaaggacattccaaggttcgagggttggtggggtaccaaaaaagag
gaacggttcttaatgaagccgcagtttgagcccatgtccaatgcagatgcctggcaaatc
agtaacccccctgtcctatcgctggcaccttatttagcttcattggaactttttgaagaa
gtggggatgcaggccctgattgaaaaacaaaaatccatcacgtcgtatttggagtttgtt
ttaggggaaatcgataaagatgttgatagcagttttgaaattattaccccccaggagagg
ggttgtcaactttccgttttcctgcatggacaaggtaaagtattgttcaactatctcatg
gaccatggggtaatcgttgattggcgtgaacctaatgtgatacgtttggcaccggcccct
ttttattgttcatttgaggaaatgtatcgttttggacaaatattgaaagaaggtattctg
aataaagattaa

DBGET integrated database retrieval system