KEGG   Methanogenic archaeon ISO4-H5: AR505_1322
Entry
AR505_1322        CDS       T04272                                 

Definition
(GenBank) pyrrolysine biosynthesis protein PylD
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
marc  Methanogenic archaeon ISO4-H5
Pathway
marc00300  Lysine biosynthesis
marc01100  Metabolic pathways
marc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:marc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    AR505_1322
Enzymes [BR:marc01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     AR505_1322
SSDB
Motif
Pfam: 2-Hacid_dh_C Sacchrp_dh_NADP AdoHcyase_NAD TrkA_N NAD_binding_7 Shikimate_DH AlaDh_PNT_C THF_DHG_CYH_C 3HCDH_N NAD_binding_2 ThiF F420_oxidored Pyr_redox_2 Pyr_redox UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AMH95037
UniProt: A0A0X8V1N8
LinkDB
Position
complement(1412764..1413585)
AA seq 273 aa
MTRLTNNDVKDLSENLGALEDFLVKNTGRTLKKLACEAVGMWEYAIDTKEYTCAVVPVTT
GEGIISNFSESVRDICKWLGFEAFVTKKTDISGFKEALEQKPNIIFMADDVEFLAYNIEA
KKASNNTFSTAKAYIAALSAASDMLIGKDVLIVGAGRVGSEMARLLVAKSANVTITDIDL
DKAYAVQKANPRVKVAENVREAIRAHKYILNASPAHIETEDIQEGAIISSPGVPHTFDEE
AKKKALIIHDPLAIGVAAMAMESAYYSYLGCRK
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaccagactaacaaacaacgatgtcaaagatctctccgagaacctcggagcactcgaa
gatttcctcgtgaagaacaccggcaggacccttaagaaactggcctgtgaggcagtcggc
atgtgggagtatgcgatcgataccaaggagtacacctgcgcggttgtgccagtcaccacc
ggagagggaatcatctccaacttttcggagtccgtgagggacatctgcaaatggctggga
ttcgaggcattcgtcaccaagaagaccgacatcagcggattcaaggaggcactcgagcag
aagcccaacatcatattcatggccgacgacgtggagttcctcgcttacaacatcgaggcc
aagaaggcatccaacaacaccttcagcaccgccaaggcctacatcgccgcactttccgcc
gcatccgacatgctgatcggaaaggacgtcctcatcgtcggagccggcagggtcggcagc
gagatggcaaggctgctggtggccaagagcgccaacgtcaccatcaccgacattgacctc
gacaaggcgtatgccgttcagaaggccaacccccgtgtcaaggttgcagagaacgtacgc
gaggccatccgtgcccacaagtacatcctgaacgcctctcccgcacacatagagaccgag
gacatccaggaaggagcgatcatttcctcgcccggtgtgccccacaccttcgatgaggag
gccaagaagaaggccctcatcatccacgatccccttgcaatcggtgtcgccgccatggcc
atggagagtgcttactactcctacctaggctgcagaaagtga

DBGET integrated database retrieval system