KEGG   Maribacter sp. MJ134: EJ994_14610Help
Entry
EJ994_14610       CDS       T05877                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mare  Maribacter sp. MJ134
Pathway
mare00564  Glycerophospholipid metabolism
mare01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mare00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EJ994_14610
Enzymes [BR:mare01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EJ994_14610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 GIDA NAD_binding_8 3HCDH_N HI0933_like Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AZQ59969
UniProt: A0A3Q9FK08
LinkDB All DBs
Position
3378607..3380271
Genome map
AA seq 554 aa AA seqDB search
MKSVEFSNLKRNETIAKLKKDNFDLVVIGGGITGGGIALDAASRGLKVALVEKNDFASGT
SSKSTKLIHGGLRYLKQFDFWLVKEVGSERAIVHKLAPHLVLPEKMLLPLIENGSYGKWL
TSIGLKVYDILAQVTGDDKRKMLEKKEALKLEPLLPKKILKGAGYYAEYRTDDARLTIEN
IKTSLQYGATALNYGSVTDFIYKDKRIAGVTVKDELSDETFTINSKYVISAAGPWVDELR
SVNNSKKGKRLHLTKGVHLVFPKEKLPVKQSVYFDIPDGRMMFAIPRGKVTYVGTTDTNF
NLDKDRVRTDLADAIYLLSAVNNMFPKINLEMEDIVSSWAGLRPLIHEEGKSASELSRKD
EIFTSDTGLISIAGGKLTGYRKMAERVVDRIAKMLEEDHQKELKPCTTDTIPLCGNEFKK
FKHVKKYIATIFDRIKADGFTEHDAWFLVTNYGKQTETILGYYEKRTEKDNVTRMVLAEL
QFGIAYEMVQDPMDFFIRRTGRLYFDIDSVRQFMEPVLQELQTVYKVDDTQVLKWKQTLM
EELKEHSDFSMERV
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtgttgaattttctaacctgaaaaggaatgaaaccattgccaaacttaagaag
gataattttgaccttgtagtcattggtggcggaataacaggcggtggtattgccttggac
gccgcttcaaggggcttaaaagtagcgctagtggagaaaaatgattttgcctcaggaact
agcagtaaatccaccaaactcatccatggaggactgcgctatttaaagcaattcgatttt
tggttggtaaaggaagtaggttcggaaagggccatagttcacaaattagcaccgcacttg
gtgctaccagaaaaaatgcttttgcccttaatagaaaatggctcgtacggtaaatggctc
acttccatcggtttaaaggtatacgatattttagcgcaagtgaccggggacgacaaaaga
aaaatgttggagaagaaagaagcccttaagttagaacctttgcttcccaaaaaaatactt
aagggggcagggtattacgcagaatacagaacggatgatgcccgtctcaccattgagaac
attaaaacaagtttacagtatggcgctaccgctttgaactacggttctgtgaccgacttt
atctataaagataaaaggattgctggagttacggtcaaggatgaactttccgatgagacc
tttacaatcaactcaaagtatgtcattagtgccgccggaccatgggtagatgagttaaga
agtgtcaataattccaaaaaaggaaaacgtttgcatttaaccaaaggcgttcatctggtg
ttccctaaggaaaagctccccgtaaagcaatccgtgtactttgatatcccggatggtaga
atgatgtttgccattcccaggggaaaggtaacctacgtaggcactacggacactaatttt
aacttggacaaagacagggtacgaacagatttggcagatgccatttatttgctctccgcg
gtaaacaatatgtttccaaaaattaatttggagatggaagatatcgtttcctcatgggcg
ggccttagacctttaattcatgaagagggcaagtctgcctcggaactctcacggaaagat
gaaatttttacttcggatacgggtcttatcagtattgcaggcggcaaacttaccggctat
cgcaagatggcagaacgtgtagttgatcgtatcgccaaaatgctagaggaagaccatcaa
aaagagcttaaaccatgtaccacggacaccatccccctatgtggaaatgaattcaaaaag
tttaagcacgtaaagaagtatattgccaccatttttgaccgcattaaggcagatggcttt
acggaacacgatgcttggttcttggtcactaactatgggaagcagacggagaccatttta
gggtattacgagaaaagaacggaaaaggataatgttacaagaatggtccttgccgaactc
caatttggtattgcttatgaaatggttcaagatccaatggatttctttattagaagaaca
ggtaggctctattttgatattgatagcgtaaggcaatttatggaaccagtgcttcaagaa
ctacaaacggtgtataaagtagacgatacccaagtattgaaatggaaacaaactttaatg
gaagaactaaaagaacattcggatttttctatggagagggtttag

DBGET integrated database retrieval system