KEGG   Mariniflexile sp. TRM1-10: CJ739_1216
Entry
CJ739_1216        CDS       T05592                                 

Definition
(GenBank) Heptaprenylglyceryl phosphate synthase
  KO
K17104  phosphoglycerol geranylgeranyltransferase [EC:2.5.1.41]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_1216
Enzymes [BR:marf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.41  phosphoglycerol geranylgeranyltransferase
     CJ739_1216
SSDB
Motif
Pfam: PcrB His_biosynth ThiG NMO G3P_antiterm Dus Trp_syntA IMPDH DHO_dh FMN_dh TMP-TENI DUF5461 B12-binding
Other DBs
NCBI-ProteinID: AXP80307
UniProt: A0A385BME5
LinkDB
Position
complement(1390926..1391648)
AA seq 240 aa
MRNIYQSILKSIATKEKLLAVLIDPDKFSVENTKFFLGKVNASIVTHIFVGGSTVEEGVT
HILVAEIKKQTTLPVILFPGDVTQITNHADGLLFLSLISGRNPDYLIGKQVESISKLRKT
KLEVISTGYILIENGKKTAVQRVTGTQPIAKTAIQNIIDTAKAGELLGMKLIYLEAGSGA
KNPVSSEIIKSVKQELQIPLIVGGGIRNKQQLAYAYDSGADLVVIGTAFEEGEAFFDALK
NT seq 723 nt   +upstreamnt  +downstreamnt
atgagaaatatataccaaagcatattaaaatcgattgctactaaagagaaacttttagct
gttttaatagaccccgataagttctccgttgagaatactaaattttttctaggtaaagtt
aatgcctctatagtaacccatatttttgttggaggtagtacggttgaagaaggcgttacc
catattttagttgccgaaataaaaaagcaaacgacgcttcctgtcatattatttccggga
gatgttactcaaattacaaaccatgccgatggattgttgtttttaagtttaatttccggt
agaaaccccgattatttaataggaaagcaagttgagtcgatttcaaaacttcgaaagaca
aaattagaggttatatcaacaggttatatacttattgaaaacggtaaaaaaacagcggtc
caaagggttacggggacacaaccaatagccaaaacagctattcaaaatataattgatacc
gccaaagcaggggagttgctgggaatgaaattgatctacttagaagcgggtagcggtgct
aaaaatccagtgtcctcagaaattattaagtcggttaaacaagaattgcaaataccatta
attgttggtggcggcattagaaataaacaacaactagcgtatgcctatgactctggtgcc
gatttggtagttataggcactgcttttgaggaaggtgaagcgttttttgatgctttgaaa
tag

DBGET integrated database retrieval system