KEGG   Mariniflexile sp. TRM1-10: CJ739_1304
Entry
CJ739_1304        CDS       T05592                                 

Definition
(GenBank) putative glycerophosphoryl diester phosphodiesterase 1
  KO
K01126  glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_1304
Enzymes [BR:marf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     CJ739_1304
SSDB
Motif
Pfam: GDPD GDPD_2
Other DBs
NCBI-ProteinID: AXP80395
UniProt: A0A385BMS9
LinkDB
Position
complement(1495863..1496726)
AA seq 287 aa
MINKSILFFAKLIICSCQTDDIITQDGLFPADFSKQNPIYYTKVIAHRGGADLAPENTMA
AFQKAIDIKADYIEFDLHKTKDDSLVVIHDSSVDRTSSFGEKGAISQMTYEELSLIKVGC
PDKFGQNYINEKIPTLRDVFKLSKGKIEVYLEMKVGNIENKVLTVIEKMGVSDEVIVSSF
NFTSLMKIRLLNADIKIIYIVSKVDKKYIDEAKTINSFGIAIPNDFTLIKEFIATATEQG
LKTHVYTVNNIEEIKRLMDLGVYAVMTDIPDRALEIKDGKILTNKYK
NT seq 864 nt   +upstreamnt  +downstreamnt
atgataaataaatctatacttttttttgctaagttaataatctgttcttgtcaaacagat
gatattataacacaagacggtttatttcctgctgatttttcaaaacaaaatccaatctat
tatacaaaagtaattgcccatagaggtggagcagatttagcaccagaaaacacaatggca
gcatttcaaaaagctattgatattaaagcagattatattgaatttgatcttcataaaact
aaagatgattcattagttgtcattcacgattcatctgtagacagaacaagttcttttgga
gaaaaaggtgctatttctcaaatgacatacgaagaactttcattaataaaagttggttgt
ccagataaatttggacaaaattatataaatgaaaaaatcccaacattaagagatgtattt
aagttatctaaaggtaaaatagaagtttatcttgaaatgaaggtaggaaatatagagaac
aaagttttaacagttatagagaaaatgggagtaagtgatgaagtaattgtttcttcattt
aactttacttctcttatgaaaattcggttattgaacgccgatatcaaaattatttatata
gtatctaaggtagataaaaaatatatagacgaagcgaaaaccattaattcttttggcatt
gccattcctaatgattttacacttattaaagaatttatagctacagcaactgaacagggg
ttaaagactcatgtatataccgtaaataatattgaagaaattaaaagattaatggattta
ggggtttatgcagttatgacagacatcccggatagagcgttagaaattaaagacggaaaa
attttgacaaacaaatataaataa

DBGET integrated database retrieval system