KEGG   Mariniflexile sp. TRM1-10: CJ739_1448
Entry
CJ739_1448        CDS       T05592                                 

Definition
(GenBank) 1-acyl-sn-glycerol-3-phosphate acyltransferase
  KO
K00655  1-acyl-sn-glycerol-3-phosphate acyltransferase [EC:2.3.1.51]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00561  Glycerolipid metabolism
marf00564  Glycerophospholipid metabolism
marf01100  Metabolic pathways
marf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CJ739_1448
   00564 Glycerophospholipid metabolism
    CJ739_1448
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:marf01004]
    CJ739_1448
Enzymes [BR:marf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.51  1-acylglycerol-3-phosphate O-acyltransferase
     CJ739_1448
Lipid biosynthesis proteins [BR:marf01004]
 Phospholipid acyltransferase
  LPAAT/LPLAT
   CJ739_1448
SSDB
Motif
Pfam: Acyltransferase
Other DBs
NCBI-ProteinID: AXP80537
UniProt: A0A385BN18
LinkDB
Position
complement(1650892..1651566)
AA seq 224 aa
MPILIMFPILLISILKESWYPFFFKLARIWAKIILIGMGFNWKIESEQTPEKSKSYMFIA
NHTSMTDIMLMLVSVKNPFVFVGKKELTKIPLFGFFYKRTCILVDRSSEKSRKAVFLRAQ
KRLKTGVSICIFPEGGVPEEHIVLDEFKDGAFRLAINHHIPIVPITFADNKKRLSYTFFS
GSPGIMRVKIHDFLLTDNLKVEDTKALNKKAWNIIFKQLQTFNE
NT seq 675 nt   +upstreamnt  +downstreamnt
atgccaatacttattatgtttcccatacttttaatttccattttaaaggaatcgtggtat
ccattcttttttaaattggctcgtatttgggctaaaataattttaattggtatgggcttt
aattggaagattgaaagtgagcaaacgcccgaaaaaagtaaaagctatatgtttattgcc
aatcatacttctatgacagacattatgcttatgttggtttcggtgaaaaacccgtttgtt
tttgttggaaaaaaagagctgactaaaattccgttatttggatttttctataagcgtacc
tgtattttggttgatagaagttccgaaaaaagcagaaaagccgtttttttaagagcacag
aaacgattgaaaacaggggtaagtatttgtatttttcccgaaggcggtgtgccagaagaa
catattgtgttagacgaatttaaagatggtgcttttcggctggccattaaccatcatatt
cctattgtaccaataacttttgcagataacaaaaagcgactttcctataccttttttagc
ggaagtcctgggataatgcgtgtaaaaatccatgattttttattgaccgataatttaaag
gttgaagacaccaaagctttaaataaaaaggcctggaacattattttcaaacaattacaa
accttcaatgaataa

DBGET integrated database retrieval system