KEGG   Mariniflexile sp. TRM1-10: CJ739_147
Entry
CJ739_147         CDS       T05592                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K17103  CDP-diacylglycerol---serine O-phosphatidyltransferase [EC:2.7.8.8]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00260  Glycine, serine and threonine metabolism
marf00564  Glycerophospholipid metabolism
marf01100  Metabolic pathways
marf01110  Biosynthesis of secondary metabolites
Module
marf_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_147
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CJ739_147
Enzymes [BR:marf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.8  CDP-diacylglycerol---serine O-phosphatidyltransferase
     CJ739_147
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-ProteinID: AXP79247
UniProt: A0A385BJI4
LinkDB
Position
complement(128916..129665)
AA seq 249 aa
MKQYIPNALTLLNLFCGSIAVIFAVNNHFVAAALFVFLGIFFDFFDGFAARKLHVQSALG
IQLDSLADMVTSGVVPGIIMYKLLSLSVDAPSMVTDWDSNMKPVSFTISLVPLIGLCITL
ASAYRLAKFNIDEDQQTYFKGLPTPANTLLIVSLPLIIEFQNNDLINAIIVNKWFLMTLT
ALSCYLLNSSIKLFALKFKDWSFKANATRYIFIILCMIFLIVLQFAAIPLIILLYIGMSV
FENVASKLK
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagcaatatatacctaatgcgttaaccttattaaaccttttttgtggaagtattgct
gttatttttgcagttaataaccactttgttgccgcggcattatttgtgtttcttggtata
tttttcgatttttttgatggttttgcagccagaaaattgcatgtgcaaagtgccttgggc
attcaattggattcacttgccgatatggtaaccagtggagtggttcctggaattattatg
tataagttgttgagcttgtctgttgacgctccatcgatggtaactgattgggattccaat
atgaaacctgttagttttacaatttcgttggtgccattaattggtttatgtattacctta
gcttcagcatacagattggccaaatttaatatagacgaagaccagcaaacctattttaaa
ggcttgccaacacctgccaataccttgctaattgtttctttgcctttaattatagaattt
caaaataacgatttaataaatgcaatcatcgttaataaatggtttttaatgacacttacc
gcattgagttgttacctgcttaattcaagtattaaactatttgccttaaagtttaaggat
tggagttttaaagccaacgcaacccgttacatttttatcatactttgtatgatcttttta
attgtgttgcagtttgctgcgataccactgattatactactttatataggcatgtctgtt
tttgagaatgtcgcttccaaattaaaataa

DBGET integrated database retrieval system