KEGG   Mariniflexile sp. TRM1-10: CJ739_1623Help
Entry
CJ739_1623        CDS       T05592                                 

Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00240  Pyrimidine metabolism
marf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    CJ739_1623
Enzymes [BR:marf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CJ739_1623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AXP80710
UniProt: A0A385BNU1
LinkDB All DBs
Position
complement(1850231..1850878)
Genome map
AA seq 215 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFARQKVEIFKPTIDVRYNEDM
VVSHDANQIRSTPVPAAANIPILADGCDVVGIDEAQFFDDEIVRVCNDLANKGVRVIVAG
LDMDFKGNPFGPMPNLMATAEYVTKVHAVCTRTGNLAQYSYRKGKNDNLVLLGEVDEYEP
LSRAAYYKAMTRDKVRNMKVNDAEELTPKTQNPDA
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtttcttgaaaatacagtaaatcataaagaacaatttggatggattgaagttatctgt
ggctcaatgttttcaggaaaaaccgaagaactaatccgaaggcttaaacgcgcgcaattt
gcccgacaaaaagtagagatttttaaacctaccattgatgtgcgttacaacgaagatatg
gtagtgtcgcacgatgccaaccaaattcgttctacccccgttcctgcagcggctaatatc
cctattttggccgatggctgtgatgtcgttggcattgacgaagcccagttttttgatgac
gaaattgtacgtgtttgcaatgatttggccaacaaaggtgttcgagttattgtagctgga
cttgatatggactttaaaggcaatcccttcggccccatgcccaatttaatggcaactgcc
gaatatgttaccaaagtccacgctgtttgtaccagaacaggcaatttagcgcaatacagt
taccgaaaagggaaaaatgataatttggtgttattaggtgaagttgacgaatacgaacct
ttaagcagagccgcttattacaaagccatgacacgcgataaagttagaaacatgaaggtg
aatgatgccgaagaactgactccaaaaacccaaaacccggatgcctaa

DBGET integrated database retrieval system