KEGG   Mariniflexile sp. TRM1-10: CJ739_1719
Entry
CJ739_1719        CDS       T05592                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00057  glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC:1.1.1.94]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
marf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_1719
Enzymes [BR:marf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.94  glycerol-3-phosphate dehydrogenase [NAD(P)+]
     CJ739_1719
SSDB
Motif
Pfam: NAD_Gly3P_dh_C NAD_Gly3P_dh_N F420_oxidored
Other DBs
NCBI-ProteinID: AXP80805
UniProt: A0A385BNY9
LinkDB
Position
complement(1971977..1972978)
AA seq 333 aa
MNEPLKYAVFGAGSWATAIVKMLCENLDEVGWYMRSVYTKEHLLKERHNPNYLSSVEFHV
EQLKLSNDINDMANYADVLIFVIPSAFIYSELQKLHVDISNKIIVSAVKGIIPETGLLVG
EHFHEAYKIPYNNIAVIAGPCHSEEVALERLSYLTISCSDAKKAQAIADSLSSDYIKTKI
SDDIIGVEYAVMLKNIYAIAAGIAHGLGYGDNFQSVLMSNSIREMKRFIKKMHKMKRNIN
NSAYLGDLLVTGYSVFSRNRMFGNMIGKGYTVKSAQMEMSMVAEGYYATKSAHLLNEKNK
KKTRLPIINAVYDILYEGKDPKKTFKKLTEKLD
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaatgaacctttaaaatacgcggtttttggtgcaggaagttgggcaacagccattgta
aaaatgctttgcgaaaatttagatgaagtaggttggtacatgcgcagtgtttataccaaa
gagcatttacttaaagagcgtcacaacccaaattatttaagttcggtagagtttcatgta
gagcaactaaagcttagtaacgatatcaacgacatggccaattatgccgatgtgcttatt
tttgtaatcccttctgcctttatttatagcgaattacaaaaattacatgttgatatttcc
aataaaattattgtttcggcagtaaaaggcattattccagaaacaggtttgttggttggt
gaacattttcatgaagcttacaaaataccttacaacaatattgcggtaatagcgggtcca
tgccattctgaagaagtggctttagaacgtttatcgtacctaaccatttcatgttcagat
gctaaaaaagcccaagctattgccgatagtttgtcgagcgattacataaaaacaaaaatt
agcgacgacattattggtgtagaatatgccgttatgcttaaaaatatatacgctattgcg
gcgggtattgcccacggattgggttatggtgataatttccagagtgtgcttatgagtaac
tccattcgtgaaatgaaacgttttattaaaaaaatgcataaaatgaaacgtaacataaat
aattccgcctatttgggcgatttattggtaacaggctattcggtattttctagaaaccgt
atgtttggaaacatgattggaaaaggctacaccgtaaaaagtgcacaaatggaaatgagc
atggttgccgaaggctattacgccaccaaaagtgctcatttactaaacgaaaaaaacaaa
aagaaaacacgcttgcccattatcaatgcggtttacgatattttatacgaaggtaaagac
ccgaaaaaaacctttaaaaagttgactgagaaattggattaa

DBGET integrated database retrieval system