KEGG   Mariniflexile sp. TRM1-10: CJ739_1822Help
Entry
CJ739_1822        CDS       T05592                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00620  Pyruvate metabolism
marf00680  Methane metabolism
marf01100  Metabolic pathways
marf01120  Microbial metabolism in diverse environments
marf01200  Carbon metabolism
Module
marf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CJ739_1822
  09102 Energy metabolism
   00680 Methane metabolism
    CJ739_1822
Enzymes [BR:marf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CJ739_1822
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AXP80907
UniProt: A0A385BP46
LinkDB All DBs
Position
complement(2094843..2097431)
Genome map
AA seq 862 aa AA seqDB search
MSVEPKLTRFKQHVLSKYQIYNSIFMTLPFDAITKTGALLPLFHETCQKGFKNGDDPTTI
VDTFFKKYQGRRSKESQINLLFRFIQYIERQVVLFDAVEDAAFPIVNNMEGIGTLRNLKE
SAVSNNNLEALQNYLEEFKVRIVLTAHPTQFYPGSVLGIITDLTEAIKKNNLSEINNLFA
QLGKTPFFKHEKPTPYDEAKSLIWYLENVFYQSFGEIYNYIQQNIYDDGKKHNEIINIGF
WPGGDRDGNPFVKPDTTLRVAKKLKQAILKKYYADLKNLRRKLTFRGVEERIIRLETIFY
NFSINLDYPEAITSKAFLKELLSIRNVIVEEFQSLYVNEINSLINRIHLFGYNFATLDIR
QDSRIHHDVFTTVIDHLISNGNTSFPKNYHDLSEAEQIKILSEVTDISVDINVFDDEMVY
NTLKTIEAIKDIQESNGERGANRYIISNNQTALNMMQLFAMLKIVAFKDDLTVDVVPLFE
TITDLENAPAVMEQLYTNPAYMTHLKSRGNKQTIMLGFSDGTKDGGYLMANWGIYTAKEM
LTEMSRKYGITAIFFDGRGGPPARGGGKTHQFYASLGPKIEDKEVQLTVQGQTISSNFGT
LDSSQYNLEQLISSGMFNRLGKEKHELSDEDRMVMDDLAETSYQAYKDFKSHPMFIPYLE
RMSTLKYYAKTNIGSRPSKRGSSDKLVFSDLRAIPFVGSWSQLKQNVPGFFGVGTALKKY
EEKGEFNKVEALYKNSKFFKTLLENSMMSLTKSFFDLTKYMSKDEEFGDFWNIIYSEYIT
TKTLLLKLTGYKQLMENEPSGKASIEVRESIVLPLLTIQQYALKKIQELEKEDVKDTEQI
KIFEKIVTRSLFGNINASRNSA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaaccgaaattaacacgattcaaacaacacgtactgtctaaataccaaata
tacaatagtatatttatgaccttaccttttgatgctattacaaaaacaggggcgttactg
cctttgtttcatgaaacctgccaaaaaggatttaaaaatggagacgacccaaccaccatc
gttgatacgttctttaaaaaataccaaggaagacgttctaaggaaagccaaataaatcta
ctttttaggtttatacaatatatagaacgccaagtggttttatttgatgctgttgaagat
gccgctttccctattgtaaacaacatggaaggtattggcactttaagaaaccttaaagaa
tcggccgtttccaacaacaatttggaagctttacaaaattatctcgaagagtttaaagta
cgcattgttttaactgcacatccaacacaattttatccgggctctgtacttggtattatt
acggatttaacagaggccattaaaaaaaataacctatctgaaattaacaacctatttgct
caattaggaaaaacgcctttctttaaacacgaaaagccaacaccctatgacgaagcaaaa
agcttaatatggtatttagaaaatgttttttatcaatcttttggagaaatttataattac
atccaacagaatatttacgatgacggtaaaaaacacaacgaaataatcaatattggtttt
tggccaggtggtgaccgcgatggaaacccgtttgtaaaaccagacaccacccttcgcgta
gcaaaaaagcttaaacaagctatcttaaaaaaatattatgccgacttaaaaaacttaaga
cgcaaacttacttttagaggtgtagaggaacgcattatacgcttagaaactattttctac
aattttagcatcaacttagactaccctgaagctattacttcaaaagcgtttcttaaagaa
ttattaagtattagaaacgttattgttgaagaattccaatcgctttacgttaatgaaata
aatagcttaattaaccgcatccatttattcggatataattttgcaaccctggatattaga
caagatagcagaatccaccatgatgtttttacaacagtaattgaccatttaattagcaat
gggaacacatcattcccaaaaaactaccacgatttatctgaagctgaacaaattaaaatt
ttatcggaagttacagatatcagtgttgatatcaatgtgtttgatgatgaaatggtttac
aacactttaaaaaccatcgaggctattaaagatatacaggaaagtaatggcgagcgcggc
gctaatagatacattattagcaacaaccaaacggctttaaatatgatgcagctttttgcc
atgcttaaaatagtggcatttaaagatgacttaaccgtagatgtggtaccgcttttcgaa
accattaccgacttagaaaatgcccctgccgtcatggagcaattatatacaaatccagca
tacatgacacatttaaaaagccgtggcaacaagcaaactattatgctaggtttttctgat
ggcacaaaagatggcgggtatttaatggctaactggggtatttataccgcaaaagaaatg
cttaccgaaatgtctagaaaatatggtattactgctatattttttgatggacgtggaggt
cctccggcaagaggtggtggaaaaacacaccagttttatgcatctttagggcctaaaatt
gaagataaagaggtacagcttaccgttcaaggacaaaccataagttctaattttggaact
ttagattcgtctcaatacaatttagaacagcttataagttcgggcatgtttaaccgctta
ggaaaagaaaaacatgaactatctgatgaagatagaatggtcatggacgatttagccgaa
acaagctaccaagcttataaagattttaaaagccatcccatgttcattccgtacttggaa
cgcatgagtactttaaaatattatgctaaaaccaatattggaagcagaccgtcaaaaaga
ggttcttcagataaattagttttctctgatttaagagccattccttttgtggggtcttgg
agccaattaaaacaaaatgttcccggtttttttggcgttggaacagcattgaaaaaatat
gaagaaaaaggtgaatttaacaaagtagaagctctatataaaaattctaaattctttaaa
actttactggaaaacagcatgatgagtttaacaaaatcatttttcgacttaacaaaatac
atgtctaaagatgaagaatttggcgatttttggaatattatttacagcgaatatattaca
acaaaaacattattgttaaaacttacgggttacaaacaattaatggaaaacgaaccttct
ggaaaggcttctattgaagttagggaatctattgttttaccgttgcttaccatacagcag
tatgcacttaaaaagattcaggaactggaaaaagaagacgtaaaagataccgagcaaatt
aagatttttgagaagattgtgacacgctctctttttggaaatattaatgctagtagaaat
tcagcataa

DBGET integrated database retrieval system