KEGG   Mariniflexile sp. TRM1-10: CJ739_3060Help
Entry
CJ739_3060        CDS       T05592                                 

Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
marf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_3060
Enzymes [BR:marf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     CJ739_3060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like Pyr_redox_2 GIDA Lycopene_cycl Pyr_redox_3 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AXP82123
UniProt: A0A385BSU1
LinkDB All DBs
Position
3640741..3642354
Genome map
AA seq 537 aa AA seqDB search
MFNRNTLIIQLKKQPAWDVIIIGGGATGLGVALDSVTRGFSTLLLEQVDFAKGTSSRSTK
LLHGGVRYLAQGNIDLVKEALYERGLLLKNASHLVCNQSFIIPNYTWWDTFKYTIGLKIY
DTLAGKLSFGKSMRINKKDTLSRLSTIKNGKLKGGVVYHDGQFDDSRLAVNIAQTAIEHG
ATVLNHFKVNQLSKNDDGIVNGVIAEDMETKATYTLNAKVVINATGVFTDEILKMDNSEA
KDMVRPSQGIHLVLDKSFLPGKDAIMIPKTTDGRVLFLVPWHNKVVVGTTDTLLDSHSLE
PTALDKEVDFIMTTANNYLTKKVGKEDVLSIFAGLRPLAAPKDKSEKTKEISRSHKIIVS
NSELITITGGKWTTYRRMAQDTINKAISIGKLKYVSCKTKNIKIHGATTSNDKTRHQYIY
GSDQEGIQSLIATNPELGETVHERLPHTKAEIIWAIRYEMARTVEDILARRVRTLFLDAR
ATLEIIPMVAKMLAEELDKDAVWEQQQIKEFTNIANQYVLETVSLKENRIKRIENRK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
ttgtttaacagaaatactttgataatccaattaaaaaagcagcctgcttgggatgtgata
attattggaggaggcgccactggattaggtgttgctttagatagtgtcacacgtggattt
agcacccttttattagaacaagtagatttcgcaaaaggaacctctagtcgaagcacaaaa
ctgcttcatggcggtgttcgttatttagcgcaaggcaacattgatttagtaaaggaagca
ctatacgaaagaggcttgttattgaagaatgcctcacatttagtctgcaatcagtctttt
ataattccaaactatacgtggtgggacacatttaaatatactatagggcttaaaatttat
gatacgctagcaggtaaattaagttttggaaaatcgatgcggattaacaaaaaagacacc
ctttcaagattaagtactatcaaaaatggaaaacttaaaggaggtgtggtgtatcatgat
ggacagtttgacgattccaggttagcggtaaatattgcccaaacggccatagaacatggg
gctactgttttaaatcattttaaagtaaatcagttgtcgaaaaacgatgatggcatagtc
aatggagttatagctgaagatatggaaactaaggccacctataccttaaacgccaaagtt
gttataaatgctacaggtgtttttaccgatgagattttgaaaatggataattcagaagca
aaagacatggtgcgtccaagccaaggaatccatttagttttagataaatcttttttgccc
ggaaaggatgctattatgataccaaaaaccactgacggcagggtattgtttttggtgcca
tggcataataaagtggttgttggtaccaccgatacgttacttgatagtcacagtttagaa
ccaacagctttagacaaagaagtagatttcatcatgactacggcaaataattatctaacc
aaaaaagtgggtaaagaggatgtgttgagcatttttgcaggcctaagaccactggcagca
ccaaaagataagtctgaaaaaacaaaggaaatttccagaagccataaaattatcgtttca
aattctgaattaataaccattaccggtggcaaatggacgacctatagacgcatggcgcag
gataccataaataaagctatttcgatagggaaattgaagtatgtatcatgtaaaacaaaa
aacataaaaattcatggcgctacaacatctaatgataaaacccgccatcaatatatttac
ggaagcgaccaagagggcattcaaagtttaattgcaacaaatcctgaattgggtgaaaca
gtacatgaacggttaccccataccaaagcagaaattatttgggcgattcgatacgaaatg
gcaagaaccgtagaagatattttggctcgacgtgttcgcaccttgtttttagatgcccgc
gcaacattagaaataattcctatggtggcaaaaatgttggctgaagaattagataaagat
gctgtatgggagcaacagcaaattaaggaatttacaaatattgccaatcagtatgtttta
gagactgtttcgttaaaagagaatagaataaagagaatagaaaatagaaaatag

DBGET integrated database retrieval system