KEGG   Mariniflexile sp. TRM1-10: CJ739_3188
Entry
CJ739_3188        CDS       T05592                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
marf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_3188
Enzymes [BR:marf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     CJ739_3188
SSDB
Motif
Pfam: CDP-OH_P_transf YwiC
Other DBs
NCBI-ProteinID: AXP82250
UniProt: A0A385BT88
LinkDB
Position
complement(3808198..3808794)
AA seq 198 aa
MFTFKNFNIADWFSFYRIVAVPLLILLIILDERLIFTCFLMVSYLTDAIDGYLARKLKIT
SARGSQLDSFGDQLTLVMGLIGLFYFEVEFIKSNISIIIIVLSPYIAQMILAYYKYGKAT
AFHTYLAKLSAVLQGVFILWALFLEPNYVLFYMMIVFGLLETIEEIILIFMYDEWVSDVK
GLYWASKDKRRLNKKKSK
NT seq 597 nt   +upstreamnt  +downstreamnt
atgttcacattcaaaaattttaatattgcagattggttctccttttacaggatagtggca
gttcccttattgattttattgatcatactggatgagcgtttaatttttacatgcttcctt
atggtaagttacctcaccgatgccattgatggctatttagcacgaaaacttaaaattacg
agcgctagaggttcccaacttgattcttttggagaccagttgactttagttatgggttta
attgggcttttttattttgaagtggaattcatcaaatcaaatatcagcatcataatcatt
gtcttgtcaccatatatcgcacaaatgatacttgcctactataaatacggaaaagccaca
gcgttccatacctatttagcaaaactatctgctgtactacaaggtgtttttattctttgg
gcactctttcttgagcctaattatgtactattctatatgatgattgtctttggtctatta
gaaaccattgaagaaatcatattgatttttatgtatgatgagtgggtttcagatgtgaaa
gggctttattgggcttcaaaagataaacgaagacttaataaaaagaaatctaaataa

DBGET integrated database retrieval system