KEGG   Mariniflexile sp. TRM1-10: CJ739_3894
Entry
CJ739_3894        CDS       T05592                                 

Definition
(GenBank) prenyltransferase
  KO
K17105  geranylgeranylglycerol-phosphate geranylgeranyltransferase [EC:2.5.1.42]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_3894
Enzymes [BR:marf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.42  geranylgeranylglycerol-phosphate geranylgeranyltransferase
     CJ739_3894
SSDB
Motif
Pfam: UbiA MMPL DUF3488
Other DBs
NCBI-ProteinID: AXP82953
UniProt: A0A385BV09
LinkDB
Position
4672404..4673276
AA seq 290 aa
MIAMVQLLIKYALLEPFGVQTSLDTLGMTLLILATICIAAAGNIINDIFDVETDAVNKPD
KLIVGKSISEKTAYNLFIIFNVLGVGIGFYLSHLVDRNAFFSLFVIISVLLYVYASYLKQ
TLLIGNIVISVLVALTLIIVGIFELLPSTTSINQQTQLTFFKIIFDYAVFAFIINLLREI
TKDLEDINGDHKAGMNTLPIIIGSERATKVLFVLSFIPLFVISHYVVNSLYKNQVAVLYF
LIFIIAPLLYISIKLFSASTKKDFHHISNVFKLVMLFGMLSLLLYKYILL
NT seq 873 nt   +upstreamnt  +downstreamnt
atgattgccatggtgcaattactaattaaatatgcacttttagaaccttttggcgttcaa
acaagtttggatactttaggaatgacgcttttaatattagcaactatttgcatcgcagct
gctggtaatattatcaatgatatttttgatgttgaaaccgacgctgttaacaaacccgat
aaacttattgttggtaaatccatttcagaaaaaaccgcttacaacttgtttatcattttt
aatgtactaggtgtcggcatcgggttttatttatcacatttggtagatagaaatgccttt
ttctccttatttgttatcatttctgtattgctttatgtgtatgcaagctatttaaaacaa
acccttttaattggtaatattgttatttcagttttagtcgcattaacattgattattgtg
ggtatctttgaattacttccttcaactacaagcatcaaccagcaaacacaattaactttt
tttaagattatttttgattatgcggttttcgctttcattattaatttacttcgagaaata
accaaagaccttgaagacattaatggcgaccataaagctggtatgaataccttgcctatt
atcattggtagtgaacgagccactaaagtactgttcgttttatcttttatccccttattt
gttattagtcattatgttgttaattcgctttataaaaaccaagtagccgttttatatttt
ttaatctttataatcgccccactactctatatatctattaaactttttagcgcatcgaca
aaaaaagattttcaccatattagtaatgtatttaagttagtaatgctttttggaatgctt
tcattacttttatacaagtatattttattataa

DBGET integrated database retrieval system