KEGG   Mariniflexile sp. TRM1-10: CJ739_425
Entry
CJ739_425         CDS       T05592                                 

Definition
(GenBank) Putative lipid kinase BmrU
  KO
K07029  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00561  Glycerolipid metabolism
marf00564  Glycerophospholipid metabolism
marf01100  Metabolic pathways
marf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    CJ739_425
   00564 Glycerophospholipid metabolism
    CJ739_425
Enzymes [BR:marf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     CJ739_425
SSDB
Motif
Pfam: DAGK_cat NAD_kinase DAGK_acc PFK
Other DBs
NCBI-ProteinID: AXP79523
UniProt: A0A385BKC0
LinkDB
Position
435099..435986
AA seq 295 aa
MKSKIKLLLVINPISGGSEKGVITKDIQNIVLNQHATLETYQTTGDNDEKHIKDIVEKKS
IDRILVAGGDGTIQLVAKAILESNIPLGIIPAGSANGLASNFNLPDNLEEQVKIVLGNHF
INMDVISVNNHLCLHIADIGINALLIKNYENSSMRGKLGYALQTIPTLVESDLPYRFSIE
INGKEIQKAGIMIAIANANQFGTGAVINPDGKIDDAIFEVLLFRKMNVIDILNTLSETSL
RDPEFVECFATKKVVIHCKKKIPLQVDGEYIGEVNTIEASIVPSKIKIMLPRKTV
NT seq 888 nt   +upstreamnt  +downstreamnt
atgaaatcaaaaataaaattgctattggttatcaatccgatttcaggaggttctgaaaaa
ggtgtaattactaaagacatacaaaatatcgttctaaatcagcatgcgacattagaaacc
taccaaaccacaggcgataatgatgaaaaacatattaaagacattgtagaaaaaaaatcc
attgataggattttggttgcaggtggagacggcaccatacagctagttgcaaaagctatt
ctagaatcaaacatacctctcggcattattcctgctgggtctgctaacggattagcatcc
aatttcaacttaccggacaacctcgaagaacaagttaaaattgtcttagggaatcatttt
attaatatggacgttatttcagtaaacaaccatctttgccttcatattgctgatattggt
attaatgcccttttaattaaaaactacgaaaactcgtctatgagagggaaattagggtat
gcccttcaaaccattcctacgcttgtagaatctgatttgccctatcgtttttcaatagaa
ataaacggaaaagaaatacaaaaagcaggcatcatgatagccattgcaaacgccaatcaa
tttggtactggagctgttattaatcccgatggaaaaatcgatgatgctatttttgaagtg
ttgcttttcagaaaaatgaatgtcatcgatattttaaacaccctaagtgaaacgtcttta
agagatcctgaatttgtagagtgcttcgctacaaaaaaagtagtgatacactgcaagaaa
aaaatacctcttcaagttgatggcgaatacattggtgaagttaacactattgaggccagc
atagtaccttcaaaaataaaaattatgttgccaagaaaaacagtttaa

DBGET integrated database retrieval system