KEGG   Mariniflexile sp. TRM1-10: CJ739_450
Entry
CJ739_450         CDS       T05592                                 

Definition
(GenBank) Phosphatidate cytidylyltransferase
  KO
K00981  phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
marf01100  Metabolic pathways
marf01110  Biosynthesis of secondary metabolites
Module
marf_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_450
Enzymes [BR:marf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     CJ739_450
SSDB
Motif
Pfam: CTP_transf_1 Iron_permease FA_desaturase
Other DBs
NCBI-ProteinID: AXP79548
UniProt: A0A385BK95
LinkDB
Position
461864..462685
AA seq 273 aa
MKEILIRSLSGLLYVLLLILCLSHLQSLIALFFVFGIVCLAEFKKLIQLKNIIPYFIFGV
LYAFFVYWQLILNTNAGIDEAIQILMVLTIFIELFLIKDLFSEKTTPLFTSKQFILTTFY
ISSAFVFLVLIADYHENYNPNILLGAFILVWVNDSFAYLIGKNFGKQKLFEKISPKKTVE
GFLGGLLFSCIASYFIATFTQTLDFTSWLILGIIITVFGTLGDLIESKFKRQANVKDSGT
IMPGHGGLLDRLDSIIFAAPFIYLFLRILHYVS
NT seq 822 nt   +upstreamnt  +downstreamnt
atgaaagaaattcttattcgatcactttctggtttactctatgtcttgcttttaattctg
tgtttaagccatctacaatcactaattgctttgttttttgtgtttggcattgtttgttta
gccgaatttaaaaagctcatccagcttaaaaacatcatcccgtattttatatttggtgtc
ctatatgctttttttgtgtattggcagctcattttaaatacaaatgccggtatcgacgaa
gctattcaaatactaatggtactaactatatttattgaattgtttttaattaaagacttg
ttttcagaaaaaacaacaccactatttacttctaaacaatttatattaaccaccttttac
atttcaagcgcttttgtttttttagttttaatagccgattatcatgaaaactacaatccg
aacattctattaggagcttttattttagtatgggtgaacgattcttttgcttatttaatt
ggtaaaaattttggtaaacaaaagcttttcgaaaaaatttcaccaaaaaaaacagtagaa
ggttttctaggaggtttgcttttttcgtgcatagcaagttattttattgctacctttaca
caaactttagattttacaagttggcttattttaggtatcattataaccgtatttggtacg
ttgggcgacttaatagaatctaagttcaaaagacaagcaaacgtaaaggacagtggtact
ataatgcctggtcacggtggcttgttggatcgattggacagcattatttttgctgctcct
tttatttatttatttttaagaattttacactatgtttcataa

DBGET integrated database retrieval system