KEGG   Mariniflexile sp. TRM1-10: CJ739_451
Entry
CJ739_451         CDS       T05592                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
marf  Mariniflexile sp. TRM1-10
Pathway
marf00564  Glycerophospholipid metabolism
marf01100  Metabolic pathways
marf01110  Biosynthesis of secondary metabolites
Module
marf_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:marf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CJ739_451
Enzymes [BR:marf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CJ739_451
SSDB
Motif
Pfam: PS_Dcarbxylase ATP-synt_8 DUF4131
Other DBs
NCBI-ProteinID: AXP79549
UniProt: A0A385BKF3
LinkDB
Position
462675..463331
AA seq 218 aa
MFHKEGHKIIFLTFVFVVGCSLLADSFIPITWLRTIVLSVLLIFLILILQFFRNPKRRTA
LNNKSVVSPVDGKVVVIEEVFEKEYFNDKRLQVSVFMSPINVHVTRYPISGNVIFSKYHP
GKYLVAWHPKASEENERTTVVVENETYGKVLYRQIAGALAKRIVNYAKINDKVIQGGESG
FIKFGSRVDLFLPIGTKIKVQLNQKVRGGESIIAETND
NT seq 657 nt   +upstreamnt  +downstreamnt
atgtttcataaagaaggacataaaataatatttctaacatttgtatttgttgttggctgt
tctttattggccgacagtttcatacccataacttggttacgaaccattgttttaagtgtg
ttattaatatttttaatacttattcttcaatttttcagaaacccaaaacgtcgtactgct
ttaaataacaaaagtgttgtgtctcctgttgacggtaaagtcgttgttattgaagaagtt
tttgaaaaagaatattttaacgacaaacgtttacaggtaagtgtttttatgtctccaata
aatgttcatgttacacgttaccctattagcggcaatgtgatatttagtaaataccatcct
ggcaaatatttagttgcatggcatcctaaagctagcgaagaaaacgaacgtactacagtt
gttgttgaaaatgaaacttatggcaaagtattatacagacaaatagccggagctttggca
aaacgtattgtgaactatgctaaaataaacgataaagtaatccaaggtggtgagtctgga
tttataaaatttggttcaagggttgatttatttttaccaataggaacaaaaataaaagta
caacttaaccaaaaagttcgaggaggtgaaagtattattgcagaaacaaatgactga

DBGET integrated database retrieval system