KEGG   Mycoplasma arginini: MARG145_0569Help
Entry
MARG145_0569      CDS       T04176                                 

Gene name
sps1
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
marg  Mycoplasma arginini
Brite
KEGG Orthology (KO) [BR:marg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:marg01001]
    MARG145_0569 (sps1)
Enzymes [BR:marg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MARG145_0569 (sps1)
Protein kinases [BR:marg01001]
 Serine/threonine kinases: Other
  Bacterial family
   MARG145_0569 (sps1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Choline_kinase RIO1 PglD_N Pkinase_fungal MA-Mit PI3_PI4_kinase
Motif
Other DBs
NCBI-ProteinID: BAQ54535
UniProt: A0A0C6G6K2
LinkDB All DBs
Position
468516..469520
Genome map
AA seq 334 aa AA seqDB search
MLKRLDKYDNVNKHFEDFVLIGSGGYGEVYSATFKKTGKRMAIKILTVFDATKKEVNQIR
FKNECNVLKTINSKNVVRMIGYYVSENESYYAMELIKGINLRSLISKYKKIPVEEAVRIA
REICEGLADIHLANVIHRDLKPSNILIESETNTVKLIDFGISLSDDSLRVTADNKTVGSV
QYLAPEIPTRSQTASIQSDIYAFGMILYEMLAGHPVYQGIDAQAVLLLQINGEIPPLEGV
GKTIPQAVENIIIRCTAKNPSDRYKNCVEIISDLNHCLQPQAALEKRLDLSNKVVSKKRK
ISKSLTIALITLGSSAAVGLLIYLIIFLVDYFKK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaagattagataaatacgataacgttaacaaacactttgaagactttgtttta
attggaagtggcggatacggtgaggtttattcagcaactttcaaaaaaacaggtaaaaga
atggcaattaaaatattaactgtatttgatgcaacaaaaaaagaagttaatcaaataaga
tttaaaaatgaatgtaatgtactaaaaacaataaactctaaaaatgttgtgcgaatgatt
ggctattatgttagtgaaaacgaatcttattatgcaatggaattgattaaagggattaat
ttaagaagtttaatttctaagtataaaaaaattcccgttgaagaggcggtaaggatagcg
agagaaatttgcgaaggcttagctgacattcacttagcaaatgttattcatcgggattta
aaaccaagtaatatactaattgaatcagaaacaaacactgttaaattaattgattttgga
atttctttaagcgacgattctttaagggtaaccgcagataataaaaccgttggttcggtt
caatatctagctcccgaaattcctacaagaagtcaaacagcatcaattcaaagtgatatt
tatgcttttggaatgattctttatgaaatgttggcaggtcatcctgtatatcaaggaatt
gatgctcaagcagtactattattacaaattaatggagaaataccaccattagaaggtgtg
ggtaaaacaataccacaagcagttgaaaatattattatccgctgtacagcaaaaaaccca
tcagatcgatataagaattgtgtggaaataataagtgatttaaatcattgtttacagcca
caagctgctttagaaaagcgtttggatttatcaaacaaggttgttagtaaaaaaaggaaa
attagtaaatctttaacaatagccttaataactttaggctctagtgctgcagttggatta
ttaatttatttaattatttttttagtagattattttaaaaagtaa

DBGET integrated database retrieval system