KEGG   Marinobacter sp. CP1: ACP86_04475
Entry
ACP86_04475       CDS       T04052                                 

Definition
(GenBank) sugar phosphorylase
  KO
K23079  glucosylglycerol phosphorylase (configuration-retaining) [EC:2.4.1.359]
Organism
mari  Marinobacter sp. CP1
Brite
KEGG Orthology (KO) [BR:mari00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACP86_04475
Enzymes [BR:mari01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.359  glucosylglycerol phosphorylase (configuration-retaining)
     ACP86_04475
SSDB
Motif
Pfam: Alpha-amylase
Other DBs
NCBI-ProteinID: AKV95480
UniProt: A0A0K1U6U5
LinkDB
Position
939167..940609
AA seq 480 aa
MLLKNAVQLICYPDRIGNNLKDLYTVVDTHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPKVGTWDDIEAFTAKYDLCVDLTVNHISDESPEFTDFIANGFDSEYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFRQVTLSDGTKTRVWCTFTEQQIDLNYESDLAYQLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYQILDWVNQVALKHGAECLPEVHDHTSYQY
AISRRNMHPYGFALPPLLLYSLLDANSTYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIKVLIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FTPGIPQVYYVGLLAGCNDHELMEQSGELRDINRHYYTLEEVEQDIQKPVVQRLLSLMKF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFKTVKVTYTDVETGETRHLEC
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgttgctcaaaaatgcggtgcagctgatctgttacccggaccggatcggcaacaatctg
aaagacctttacaccgtggtggacacgcatctgtccgaagccatcggcgggctgcacatc
ctgccgttttttccctccaacgccgatggcggcttctcgccgctgacccacaaggaagtg
gacccgaaggtgggcacctgggacgacatcgaagcctttacggcaaagtacgatctgtgc
gtggatctgacggttaatcatatctcggacgaatcgccggagttcaccgacttcattgcc
aacggcttcgactcggaatacgccgatctgtttgtgcacgtggataaattcggcgagatc
tcaccggacgacatggcgaagattcacatccgcaaggagaaagagcccttccggcaagtg
accctgtccgacggcaccaaaacccgagtgtggtgtaccttcaccgaacagcaaatcgac
ctgaattacgaatccgacctggcctatcagctgatggaaagctacatcggatttctgaca
tcaaaaggcgttaatctgctgcggctggacgccttcggatacaccaccaaacggatcggc
accagctgctttctggtggaaccggaggtgtatcaaatcctcgactgggtcaaccaggtt
gccttgaaacacggggcggaatgcctcccggaagtacacgaccacaccagctaccagtac
gccatcagccggcgcaacatgcacccctatggcttcgccctgccgccgctgctgctctat
tcactgctggacgccaacagcacctacctgaagaactggctgcgcatgtgcccgcgcaac
atggtcaccgtactggatacccatgacggcatctgcattcccgatgtggaaggcgttttg
ccggatgagaaaatcaaagtactgatcgacaacatcgacgcccgcagcgcggaccccatc
atgcggcgctcagcggccaacattcacagcgtgggtgccatctatcagctcacctgcacc
ttttatgacgcgctgatgcaaaacgacgacgcctacatcgccgcccgggccatccagttt
ttcaccccgggcatcccacaggtttactacgtggggctactggccggctgtaacgatcac
gagctgatggaacaaagtggcgagttgcgagacatcaaccgccattactacaccctcgaa
gaagtggagcaggacatccagaaaccggtggtacaacgcctgctaagcctgatgaagttc
cgcagcaactacccggcctttgatgggcacttcgaactgaactattccaacaactcaagc
gtggccatggcctggcgccatggagactattactgccacctgtttgtagacctgaacttc
aaaaccgtgaaggtcacttacaccgatgtggaaacgggggaaacccggcacctggagtgc
tga

DBGET integrated database retrieval system