KEGG   Marinobacter sp. CP1: ACP86_07390Help
Entry
ACP86_07390       CDS       T04052                                 

Definition
(GenBank) cold-shock protein
  KO
K03704  cold shock protein
Organism
mari  Marinobacter sp. CP1
Brite
KEGG Orthology (KO) [BR:mari00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    ACP86_07390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB CusF_Ec
Motif
Other DBs
NCBI-ProteinID: AKV95992
UniProt: A0A0K1U893
LinkDB All DBs
Position
complement(1560547..1560753)
Genome map
AA seq 68 aa AA seqDB search
MSTTTGTVKFFNEAKGFGFITREGGPDVFVHYSAIQGSGFKTLAEGQQVEFTVTQGQKGP
QAENVVAL
NT seq 207 nt NT seq  +upstreamnt  +downstreamnt
atgtctactactaccggtactgttaagttcttcaacgaagcaaaaggctttggctttatc
actcgtgaaggcggcccggacgtttttgttcactacagcgctattcagggcagcggtttc
aaaactctggcagaaggccagcaggttgagttcaccgttacccagggccagaaaggtcct
caggcggagaacgttgttgccctgtaa

DBGET integrated database retrieval system