KEGG   Marinobacter sp. CP1: ACP86_08545Help
Entry
ACP86_08545       CDS       T04052                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mari  Marinobacter sp. CP1
Brite
KEGG Orthology (KO) [BR:mari00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACP86_08545
Enzymes [BR:mari01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ACP86_08545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO K_oxygenase AlaDh_PNT_C FAD_oxidored FAD_binding_3 Glutaredoxin Thi4 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AKV96205
UniProt: A0A0K1U8X3
LinkDB All DBs
Position
complement(1825377..1826963)
Genome map
AA seq 528 aa AA seqDB search
MLDANIKEQLKAYMDKLQQPIELVAAYDDSKKSQELRELLEELEPMSSKISLRTEESNDV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQDVIEQIQSLEGRFE
FETYFSLSCQNCPDVVQALNLMSVLNPNITNTSIDGALFQDEVEQREVMAVPSVYMNGEP
WGQGRMTLEEIVAKLDTSSSEKDAEKINQKDAFEVLIIGGGPAGASAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQNVKEYDVEIMNMQRAEKLIPASRPG
MLHQVRLENGATLKARSLVLSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGAEMRADEVLQKKLRSLKNVEIITSGQTTEITGE
NGKVNGLNYTDRNSGEQHHISLEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSVDESEDEAA
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatatcaaggaacagctcaaggcctacatggacaagctgcagcagccg
attgagctggttgcggcctatgacgacagcaagaagtcccaggaactccgggagctgctg
gaagagctggagccgatgtcttccaagatcagtctccgcactgaagaatccaatgacgtg
cgtcgtccgtccttcgccatcaaccgagtaggcaccgatattggcgttcgctttgcgggc
atccccatgggccacgagtttacttccctggtcctggccctgctgcaggtgggtggtcat
ccctccaaggcgtcccaggatgtgatcgagcagatccagtctctggaaggccggttcgag
tttgaaacctacttctcgctgtcctgccagaactgcccggacgtggttcaggccctgaac
ctgatgagcgtgttgaacccgaacatcacgaacacctctatcgatggggccctgttccag
gatgaagtggagcagcgcgaagtcatggcggttcccagcgtttacatgaacggtgagccc
tggggccagggccgtatgaccctggaagaaattgttgccaagctggacaccagctccagc
gagaaagacgccgagaaaatcaatcagaaagacgcctttgaggtcctgatcattggtggc
ggcccggctggcgcctctgctgccatctacgctgcgcggaagggcatttccaccggcatc
gcggccgagcgtttcggtggccaggtagctgacaccatgggcattgagaacctgatttcc
gtaccctacaccgagggtccgaaactggtggcggccatggagcaaaacgtcaaggaatac
gacgtggagatcatgaacatgcagcgcgcggagaagctgatcccggcgtcacgcccgggc
atgctccaccaggtaaggttggaaaacggtgccacactcaaagcgcgcagcctggtgctg
tccaccggtgcccgctggcgccagatgggcgttccgggagaggaagagtaccgcaacaag
ggtgtggcctactgcccgcactgcgacggccccctgttcaagggcaagcgcgtggcggta
atcggtggaggtaactccggtgtcgaggcagccatcgatctggccggtatcgtgggccat
gtaaccctgatcgaattcggtgccgagatgcgtgctgatgaggtgttgcagaagaaactg
cggagtctgaagaacgtggagatcatcacgtcaggacagaccaccgagattaccggggag
aatggcaaggtcaacggtctgaattacaccgaccgcaactccggtgagcagcatcacatc
tccctggaaggtgtgtttgtacagatcggcctggtgcccaacaccgaatggctgaagggt
gacatcgaactcagccagcacggcgagatcatcgttaacgaccgcaacgaaacctccatt
ccgggcgtttttgcagcgggcgacgcgacgaccgtgccttacaagcagatcgtgatctcc
atgggcgaaggttccaaagccgccctcagcgcctttgacttcctgatccgcaattctgtg
gacgagagcgaagacgaagcggcgtaa

DBGET integrated database retrieval system